Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LSP1, Human (HEK293, His)

The LSP1 protein may play an important role in mediating neutrophil activation and chemotaxis, suggesting its involvement in immune responses. LSP1 is known to bind actin and may influence cytoskeletal dynamics critical for cell migration. LSP1 Protein, Human (HEK293, His) is the recombinant human-derived LSP1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

LSP1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lsp1-protein-human-hek293-his.html

Purity

96.30

Smiles

MAEASSDPGAEEREELLGPTAQWSVEDEEEAVHEQCQHERDRQLQAQDEEGGGHVPERPKQEMLLSLKPSEAPELDEDEGFGDWSQRPEQRQQHEGAQGALDSGEPPQCRSPEGEQEDRPGLHAYEKEDSDEVHLEELSLSKEGPGPEDTVQDNLGAAGAEEEQEEHQKCQQPRTPSPLVLEGTIEQSSPPLSPTTKLIDRTESLNRSIEKSNSVKKSQPDLPISKIDQWLEQYTQAIETAGRTPKLARQASIELPSMAVASTKSRWETGEVQAQSAAKTPSCKDIVAGDMSKKSLWEQKGGSKTSSTIKSTPSGKRYKFVATGHGKYEKVLVEGGPAP

Molecular Formula

4046 (Gene_ID) P33241-1 (M1-P339) (Accession)

Molecular Weight

Approximately 60 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CDKL4 knockout cell line
ABC-KH2848 1 Vial

Human CDKL4 knockout cell line

Sign In for Pricing
View Details
TRNAS20-set siRNA/shRNA/RNAi Lentivector (Human)
48376091 4x 500 ng

TRNAS20-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
1700019N19Rik siRNA (m)
sc-108358 10 µM

1700019N19Rik siRNA (m)

Sign In for Pricing
View Details
Mouse Monoclonal Musashi-2 Antibody (960121) [Alexa Fluor 532]
FAB3255X 0.1 mL

Mouse Monoclonal Musashi-2 Antibody (960121) [Alexa Fluor 532]

Sign In for Pricing
View Details
KRAS (NM_004985) Human Mutant ORF Clone
RC400111 10 µg

KRAS (NM_004985) Human Mutant ORF Clone

Sign In for Pricing
View Details
Mouse Thioredoxin-related transmembrane protein 4 (TMX4) ELISA Kit
abx550674 96 Tests

Mouse Thioredoxin-related transmembrane protein 4 (TMX4) ELISA Kit

Sign In for Pricing
View Details