Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLAMF2/CD48, Rat (HEK293, His)

SLAMF2/CD48 is a GPI-anchored glycoprotein that regulates immune cells. It interacts with receptors like CD2 and CD244/2B4, activating LCK and LAT in T-cell signaling. SLAMF2 also phosphorylates CD244, leading to immunological synapse formation and targeted release of cytolytic granules by T-lymphocytes and NK-cells. Its direct interactions with CD2, CD244, and LCK contribute to immune response regulation. SLAMF2/CD48 Protein, Rat (HEK293, His) is the recombinant rat-derived SLAMF2/CD48 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

SLAMF2/CD48 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/slamf2-cd48-protein-rat-hek293-his.html

Purity

98.00

Smiles

FQDQSVPNVNAITGSNVTLTILKHPLASYQRLTWLHTTNQKILEYFPNGKKTVFESVFKDRVDLDKTNGALRIYNVSKEDRGDYYMRMLHETEDQWKITMEVYDLVSKPAIKIEKTKNLTDSCHLRLSCKVEDQGVDYTWYEDSGPFPQRNPGYVLEITITPHNKSTFYTCQVSNPVSSENDTLYFIPPCTLAR

Molecular Formula

245962 (Gene_ID) P10252 (F23-R216) (Accession)

Molecular Weight

Approximately 32-50 kDa 32-50 kDa in SDS-PAGE under reducing conditions due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Thromboxane A2 receptor (Tbxa2r)
MBS968525 Inquire

Recombinant Mouse Thromboxane A2 receptor (Tbxa2r)

Sign In for Pricing
View Details
S100P (ABT-S100P) mouse mAb Ready to use
UB-GEN-16914 100 µL

S100P (ABT-S100P) mouse mAb Ready to use

Sign In for Pricing
View Details
Mouse BTB/POZ domain-containing protein 9, Btbd9 ELISA KIT
ELI-33288m 96 Tests

Mouse BTB/POZ domain-containing protein 9, Btbd9 ELISA KIT

Sign In for Pricing
View Details
PTPRN2 (Protein Tyrosine Phosphatase, Receptor Type, N Polypeptide 2, IA-2beta, IAR, ICAAR, PTPRP) (MaxLight 750) discontinued
250710-ML750 100 µL

PTPRN2 (Protein Tyrosine Phosphatase, Receptor Type, N Polypeptide 2, IA-2beta, IAR, ICAAR, PTPRP) (MaxLight 750) discontinued

Sign In for Pricing
View Details
BRAF (7B2) Mouse Monoclonal antibody
E28PE2225 100 µL

BRAF (7B2) Mouse Monoclonal antibody

Sign In for Pricing
View Details
RPSAP22 sgRNA CRISPR Lentivector set (Human)
K2065101 3x 1.0 µg

RPSAP22 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details