Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLAMF2/CD48, Rat (HEK293, His)

SLAMF2/CD48 is a GPI-anchored glycoprotein that regulates immune cells. It interacts with receptors like CD2 and CD244/2B4, activating LCK and LAT in T-cell signaling. SLAMF2 also phosphorylates CD244, leading to immunological synapse formation and targeted release of cytolytic granules by T-lymphocytes and NK-cells. Its direct interactions with CD2, CD244, and LCK contribute to immune response regulation. SLAMF2/CD48 Protein, Rat (HEK293, His) is the recombinant rat-derived SLAMF2/CD48 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

SLAMF2/CD48 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/slamf2-cd48-protein-rat-hek293-his.html

Purity

98.00

Smiles

FQDQSVPNVNAITGSNVTLTILKHPLASYQRLTWLHTTNQKILEYFPNGKKTVFESVFKDRVDLDKTNGALRIYNVSKEDRGDYYMRMLHETEDQWKITMEVYDLVSKPAIKIEKTKNLTDSCHLRLSCKVEDQGVDYTWYEDSGPFPQRNPGYVLEITITPHNKSTFYTCQVSNPVSSENDTLYFIPPCTLAR

Molecular Formula

245962 (Gene_ID) P10252 (F23-R216) (Accession)

Molecular Weight

Approximately 32-50 kDa 32-50 kDa in SDS-PAGE under reducing conditions due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPBI Rabbit Polyclonal Antibody
E28PN2851 100 µL

PPBI Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal CXCR3 Antibody (868013R) [Janelia Fluor 525]
FAB8109RJF525 0.1 mL

Mouse Monoclonal CXCR3 Antibody (868013R) [Janelia Fluor 525]

Sign In for Pricing
View Details
Recombinant Human PH domain-containing family A member 1 (C-His)
32-10390-500 500 µg

Recombinant Human PH domain-containing family A member 1 (C-His)

Sign In for Pricing
View Details
Rabbit Polyclonal APRIL/TNFSF13 Antibody [Alexa Fluor 350]
NBP1-76767AF350 0.1 mL

Rabbit Polyclonal APRIL/TNFSF13 Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
Rabbit Polyclonal UbcH7/UBE2L3 Antibody [Alexa Fluor 405]
NBP2-99646AF405 0.1 mL

Rabbit Polyclonal UbcH7/UBE2L3 Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details
AGBL5 (NM_021831) Human Tagged ORF Clone Lentiviral Particle
RC217452L4V 200 µL

AGBL5 (NM_021831) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details