Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLAMF2/CD48, Rat (HEK293, His)

SLAMF2/CD48 is a GPI-anchored glycoprotein that regulates immune cells. It interacts with receptors like CD2 and CD244/2B4, activating LCK and LAT in T-cell signaling. SLAMF2 also phosphorylates CD244, leading to immunological synapse formation and targeted release of cytolytic granules by T-lymphocytes and NK-cells. Its direct interactions with CD2, CD244, and LCK contribute to immune response regulation. SLAMF2/CD48 Protein, Rat (HEK293, His) is the recombinant rat-derived SLAMF2/CD48 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

SLAMF2/CD48 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/slamf2-cd48-protein-rat-hek293-his.html

Purity

98.00

Smiles

FQDQSVPNVNAITGSNVTLTILKHPLASYQRLTWLHTTNQKILEYFPNGKKTVFESVFKDRVDLDKTNGALRIYNVSKEDRGDYYMRMLHETEDQWKITMEVYDLVSKPAIKIEKTKNLTDSCHLRLSCKVEDQGVDYTWYEDSGPFPQRNPGYVLEITITPHNKSTFYTCQVSNPVSSENDTLYFIPPCTLAR

Molecular Formula

245962 (Gene_ID) P10252 (F23-R216) (Accession)

Molecular Weight

Approximately 32-50 kDa 32-50 kDa in SDS-PAGE under reducing conditions due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM188 CRISPRa sgRNA lentivector (set of three targets)(Human)
46966121 3x 1.0µg DNA

TMEM188 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
PNRC2 Rabbit pAb
A16549 500 µL

PNRC2 Rabbit pAb

Sign In for Pricing
View Details
Recombinant Parvibaculum lavamentivorans 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase (metE), partial
MBS1034674 Inquire

Recombinant Parvibaculum lavamentivorans 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase (metE), partial

Sign In for Pricing
View Details
CD45RO Antibody
V2237-100UG 100 µg

CD45RO Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS806244 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
LOC100505265 3'UTR Luciferase Stable Cell Line
TU112314 1.0 mL

LOC100505265 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details