Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLAMF2/CD48, Rat (HEK293, His)

SLAMF2/CD48 is a GPI-anchored glycoprotein that regulates immune cells. It interacts with receptors like CD2 and CD244/2B4, activating LCK and LAT in T-cell signaling. SLAMF2 also phosphorylates CD244, leading to immunological synapse formation and targeted release of cytolytic granules by T-lymphocytes and NK-cells. Its direct interactions with CD2, CD244, and LCK contribute to immune response regulation. SLAMF2/CD48 Protein, Rat (HEK293, His) is the recombinant rat-derived SLAMF2/CD48 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

SLAMF2/CD48 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/slamf2-cd48-protein-rat-hek293-his.html

Purity

98.00

Smiles

FQDQSVPNVNAITGSNVTLTILKHPLASYQRLTWLHTTNQKILEYFPNGKKTVFESVFKDRVDLDKTNGALRIYNVSKEDRGDYYMRMLHETEDQWKITMEVYDLVSKPAIKIEKTKNLTDSCHLRLSCKVEDQGVDYTWYEDSGPFPQRNPGYVLEITITPHNKSTFYTCQVSNPVSSENDTLYFIPPCTLAR

Molecular Formula

245962 (Gene_ID) P10252 (F23-R216) (Accession)

Molecular Weight

Approximately 32-50 kDa 32-50 kDa in SDS-PAGE under reducing conditions due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Paxillin Rabbit mAb
E51A08552 100 µL

Paxillin Rabbit mAb

Sign In for Pricing
View Details
Tnfsf13 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4040607 1.0 µg DNA

Tnfsf13 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Sheep Coiled-coil and C2 domain-containing protein 1B (CC2D1B) ELISA Kit
MBS7201241-01 48 Well

Sheep Coiled-coil and C2 domain-containing protein 1B (CC2D1B) ELISA Kit

Sign In for Pricing
View Details
Sheep Coiled-coil and C2 domain-containing protein 1B (CC2D1B) ELISA Kit
MBS7201241-02 96 Well

Sheep Coiled-coil and C2 domain-containing protein 1B (CC2D1B) ELISA Kit

Sign In for Pricing
View Details
Sheep Coiled-coil and C2 domain-containing protein 1B (CC2D1B) ELISA Kit
MBS7201241-03 5x 96 Well

Sheep Coiled-coil and C2 domain-containing protein 1B (CC2D1B) ELISA Kit

Sign In for Pricing
View Details
Sheep Coiled-coil and C2 domain-containing protein 1B (CC2D1B) ELISA Kit
MBS7201241-04 10x 96 Well

Sheep Coiled-coil and C2 domain-containing protein 1B (CC2D1B) ELISA Kit

Sign In for Pricing
View Details