Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLAMF2/CD48, Rat (HEK293, His)

SLAMF2/CD48 is a GPI-anchored glycoprotein that regulates immune cells. It interacts with receptors like CD2 and CD244/2B4, activating LCK and LAT in T-cell signaling. SLAMF2 also phosphorylates CD244, leading to immunological synapse formation and targeted release of cytolytic granules by T-lymphocytes and NK-cells. Its direct interactions with CD2, CD244, and LCK contribute to immune response regulation. SLAMF2/CD48 Protein, Rat (HEK293, His) is the recombinant rat-derived SLAMF2/CD48 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

SLAMF2/CD48 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/slamf2-cd48-protein-rat-hek293-his.html

Purity

98.00

Smiles

FQDQSVPNVNAITGSNVTLTILKHPLASYQRLTWLHTTNQKILEYFPNGKKTVFESVFKDRVDLDKTNGALRIYNVSKEDRGDYYMRMLHETEDQWKITMEVYDLVSKPAIKIEKTKNLTDSCHLRLSCKVEDQGVDYTWYEDSGPFPQRNPGYVLEITITPHNKSTFYTCQVSNPVSSENDTLYFIPPCTLAR

Molecular Formula

245962 (Gene_ID) P10252 (F23-R216) (Accession)

Molecular Weight

Approximately 32-50 kDa 32-50 kDa in SDS-PAGE under reducing conditions due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse IL-7 ELISA kit
LF-EK50655 1×96T

Mouse IL-7 ELISA kit

Sign In for Pricing
View Details
Gamma-Aminobutyric Acid (GABA) A Receptor (β 1 (GABRB1) Human ELISA Kit
95367 96 Tests

Gamma-Aminobutyric Acid (GABA) A Receptor (β 1 (GABRB1) Human ELISA Kit

Sign In for Pricing
View Details
RGD1561778 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV648761 1.0 µg DNA

RGD1561778 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
CLASP1 Rabbit Polyclonal Antibody
TA365655 100 µL

CLASP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Perlecan (bovine, human)
CSI 001-74-04 400 µL

Anti-Perlecan (bovine, human)

Sign In for Pricing
View Details
DDX58 (NM_014314) Human 3' UTR Clone
SC216624 10 µg

DDX58 (NM_014314) Human 3' UTR Clone

Sign In for Pricing
View Details