Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLAMF2/CD48, Rat (HEK293, His)

SLAMF2/CD48 is a GPI-anchored glycoprotein that regulates immune cells. It interacts with receptors like CD2 and CD244/2B4, activating LCK and LAT in T-cell signaling. SLAMF2 also phosphorylates CD244, leading to immunological synapse formation and targeted release of cytolytic granules by T-lymphocytes and NK-cells. Its direct interactions with CD2, CD244, and LCK contribute to immune response regulation. SLAMF2/CD48 Protein, Rat (HEK293, His) is the recombinant rat-derived SLAMF2/CD48 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

SLAMF2/CD48 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/slamf2-cd48-protein-rat-hek293-his.html

Purity

98.00

Smiles

FQDQSVPNVNAITGSNVTLTILKHPLASYQRLTWLHTTNQKILEYFPNGKKTVFESVFKDRVDLDKTNGALRIYNVSKEDRGDYYMRMLHETEDQWKITMEVYDLVSKPAIKIEKTKNLTDSCHLRLSCKVEDQGVDYTWYEDSGPFPQRNPGYVLEITITPHNKSTFYTCQVSNPVSSENDTLYFIPPCTLAR

Molecular Formula

245962 (Gene_ID) P10252 (F23-R216) (Accession)

Molecular Weight

Approximately 32-50 kDa 32-50 kDa in SDS-PAGE under reducing conditions due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAPK8IP1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1267307 1.0 µg DNA

MAPK8IP1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Blmh Mouse qPCR Primer Pair (NM_178645)
MP201344 200 Reactions

Blmh Mouse qPCR Primer Pair (NM_178645)

Sign In for Pricing
View Details
Lentiviral human C18orf54 shRNA (UAS) - Lentiviral human C18orf54 shRNA (UAS, iRFP) (100)
GTR15084903 1 Vial

Lentiviral human C18orf54 shRNA (UAS) - Lentiviral human C18orf54 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
TAZ Polyclonal Antibody
MBS9132949-01 0.02 mL

TAZ Polyclonal Antibody

Sign In for Pricing
View Details
TAZ Polyclonal Antibody
MBS9132949-02 0.1 mL

TAZ Polyclonal Antibody

Sign In for Pricing
View Details
TAZ Polyclonal Antibody
MBS9132949-03 5x 0.1 mL

TAZ Polyclonal Antibody

Sign In for Pricing
View Details