Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLAMF2/CD48, Rat (HEK293, His)

SLAMF2/CD48 is a GPI-anchored glycoprotein that regulates immune cells. It interacts with receptors like CD2 and CD244/2B4, activating LCK and LAT in T-cell signaling. SLAMF2 also phosphorylates CD244, leading to immunological synapse formation and targeted release of cytolytic granules by T-lymphocytes and NK-cells. Its direct interactions with CD2, CD244, and LCK contribute to immune response regulation. SLAMF2/CD48 Protein, Rat (HEK293, His) is the recombinant rat-derived SLAMF2/CD48 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

SLAMF2/CD48 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/slamf2-cd48-protein-rat-hek293-his.html

Purity

98.00

Smiles

FQDQSVPNVNAITGSNVTLTILKHPLASYQRLTWLHTTNQKILEYFPNGKKTVFESVFKDRVDLDKTNGALRIYNVSKEDRGDYYMRMLHETEDQWKITMEVYDLVSKPAIKIEKTKNLTDSCHLRLSCKVEDQGVDYTWYEDSGPFPQRNPGYVLEITITPHNKSTFYTCQVSNPVSSENDTLYFIPPCTLAR

Molecular Formula

245962 (Gene_ID) P10252 (F23-R216) (Accession)

Molecular Weight

Approximately 32-50 kDa 32-50 kDa in SDS-PAGE under reducing conditions due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-(3-Chloropropyl)theobromine
TRC-C429330-2.5G 2.5 g

1-(3-Chloropropyl)theobromine

Sign In for Pricing
View Details
3,8-Dimethyl-2-nitro-3H-imidazo[4,5-F]quinoxaline (NO2-MeIQx)
D3693-40F 5 mg

3,8-Dimethyl-2-nitro-3H-imidazo[4,5-F]quinoxaline (NO2-MeIQx)

Sign In for Pricing
View Details
Human POLR2B qPCR Primer Pair
QH20413S 200 Tests

Human POLR2B qPCR Primer Pair

Sign In for Pricing
View Details
TBC1D28 Protein Vector (Human) (pPB-N-His)
PV134847 500 ng

TBC1D28 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
TRNAP9 sgRNA CRISPR Lentivector set (Human)
K2510901 3x 1.0 µg

TRNAP9 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Mouse Monoclonal Mouse anti-Human IgE Heavy Chain Secondary Antibody (E454 (5D5)) [DyLight 488]
NBP2-68297G 0.2 mL

Mouse Monoclonal Mouse anti-Human IgE Heavy Chain Secondary Antibody (E454 (5D5)) [DyLight 488]

Sign In for Pricing
View Details