Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLAMF2/CD48, Rat (HEK293, His)

SLAMF2/CD48 is a GPI-anchored glycoprotein that regulates immune cells. It interacts with receptors like CD2 and CD244/2B4, activating LCK and LAT in T-cell signaling. SLAMF2 also phosphorylates CD244, leading to immunological synapse formation and targeted release of cytolytic granules by T-lymphocytes and NK-cells. Its direct interactions with CD2, CD244, and LCK contribute to immune response regulation. SLAMF2/CD48 Protein, Rat (HEK293, His) is the recombinant rat-derived SLAMF2/CD48 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

SLAMF2/CD48 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/slamf2-cd48-protein-rat-hek293-his.html

Purity

98.00

Smiles

FQDQSVPNVNAITGSNVTLTILKHPLASYQRLTWLHTTNQKILEYFPNGKKTVFESVFKDRVDLDKTNGALRIYNVSKEDRGDYYMRMLHETEDQWKITMEVYDLVSKPAIKIEKTKNLTDSCHLRLSCKVEDQGVDYTWYEDSGPFPQRNPGYVLEITITPHNKSTFYTCQVSNPVSSENDTLYFIPPCTLAR

Molecular Formula

245962 (Gene_ID) P10252 (F23-R216) (Accession)

Molecular Weight

Approximately 32-50 kDa 32-50 kDa in SDS-PAGE under reducing conditions due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (45M1), CF405S conjugate, 0.1mg/mL
BNC040031-100 1x 100 µL

Mucin 5AC (MUC5AC) (45M1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF568 conjugate, 0.1mg/mL
BNC680257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF405S conjugate, 0.1mg/mL
BNC041035-500 1x 500 µL

CD8 (C8/1035), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 10 (LH2), CF740 conjugate, 0.1mg/mL
BNC740674-500 1x 500 µL

Cytokeratin 10 (LH2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C1QA / Complement C1q A-Chain (C1QA/2956), CF740 conjugate, 0.1mg/mL
BNC742956-500 1x 500 µL

C1QA / Complement C1q A-Chain (C1QA/2956), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (KRT16/1714), CF647 conjugate, 0.1mg/mL
BNC471714-500 1x 500 µL

Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (KRT16/1714), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details