Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLAMF2/CD48, Rat (HEK293, His)

SLAMF2/CD48 is a GPI-anchored glycoprotein that regulates immune cells. It interacts with receptors like CD2 and CD244/2B4, activating LCK and LAT in T-cell signaling. SLAMF2 also phosphorylates CD244, leading to immunological synapse formation and targeted release of cytolytic granules by T-lymphocytes and NK-cells. Its direct interactions with CD2, CD244, and LCK contribute to immune response regulation. SLAMF2/CD48 Protein, Rat (HEK293, His) is the recombinant rat-derived SLAMF2/CD48 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

SLAMF2/CD48 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/slamf2-cd48-protein-rat-hek293-his.html

Purity

98.00

Smiles

FQDQSVPNVNAITGSNVTLTILKHPLASYQRLTWLHTTNQKILEYFPNGKKTVFESVFKDRVDLDKTNGALRIYNVSKEDRGDYYMRMLHETEDQWKITMEVYDLVSKPAIKIEKTKNLTDSCHLRLSCKVEDQGVDYTWYEDSGPFPQRNPGYVLEITITPHNKSTFYTCQVSNPVSSENDTLYFIPPCTLAR

Molecular Formula

245962 (Gene_ID) P10252 (F23-R216) (Accession)

Molecular Weight

Approximately 32-50 kDa 32-50 kDa in SDS-PAGE under reducing conditions due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTEN Mouse mAb
A11128-01 20 µL

PTEN Mouse mAb

Sign In for Pricing
View Details
PTEN Mouse mAb
A11128-02 100 μL

PTEN Mouse mAb

Sign In for Pricing
View Details
PTEN Mouse mAb
A11128-03 1000 μL

PTEN Mouse mAb

Sign In for Pricing
View Details
PTEN Mouse mAb
A11128-04 500 μL

PTEN Mouse mAb

Sign In for Pricing
View Details
mmu-miR-7239-5p miRNA Inhibitor
MBS8297119-01 10 nmol

mmu-miR-7239-5p miRNA Inhibitor

Sign In for Pricing
View Details
mmu-miR-7239-5p miRNA Inhibitor
MBS8297119-02 20 nmol

mmu-miR-7239-5p miRNA Inhibitor

Sign In for Pricing
View Details