Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLAMF2/CD48, Rat (HEK293, His)

SLAMF2/CD48 is a GPI-anchored glycoprotein that regulates immune cells. It interacts with receptors like CD2 and CD244/2B4, activating LCK and LAT in T-cell signaling. SLAMF2 also phosphorylates CD244, leading to immunological synapse formation and targeted release of cytolytic granules by T-lymphocytes and NK-cells. Its direct interactions with CD2, CD244, and LCK contribute to immune response regulation. SLAMF2/CD48 Protein, Rat (HEK293, His) is the recombinant rat-derived SLAMF2/CD48 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

SLAMF2/CD48 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/slamf2-cd48-protein-rat-hek293-his.html

Purity

98.00

Smiles

FQDQSVPNVNAITGSNVTLTILKHPLASYQRLTWLHTTNQKILEYFPNGKKTVFESVFKDRVDLDKTNGALRIYNVSKEDRGDYYMRMLHETEDQWKITMEVYDLVSKPAIKIEKTKNLTDSCHLRLSCKVEDQGVDYTWYEDSGPFPQRNPGYVLEITITPHNKSTFYTCQVSNPVSSENDTLYFIPPCTLAR

Molecular Formula

245962 (Gene_ID) P10252 (F23-R216) (Accession)

Molecular Weight

Approximately 32-50 kDa 32-50 kDa in SDS-PAGE under reducing conditions due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTFMT Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A10]
TA503564BM 100 µL

MTFMT Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A10]

Sign In for Pricing
View Details
Recombinant Mouse SLC26A3 Protein, His (Fc)-Avi-tagged
SLC26A3-8300M 50 µg

Recombinant Mouse SLC26A3 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
CD41, CD61 (CD41b, GP2B, GP-IIb, GPIIb, GP3A, GP-IIIa, GPIIIa, GTA, HPA3, Integrin alpha 2b, ITGA2B, Integrin beta 3, ITGB3, Platelet Glycoprotein IIb of IIb/IIIa Complex) (PE) discontinued
C2394-35B-PE 100 µL

CD41, CD61 (CD41b, GP2B, GP-IIb, GPIIb, GP3A, GP-IIIa, GPIIIa, GTA, HPA3, Integrin alpha 2b, ITGA2B, Integrin beta 3, ITGB3, Platelet Glycoprotein IIb of IIb/IIIa Complex) (PE) discontinued

Sign In for Pricing
View Details
NCKAP5L Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV800643 1.0 µg DNA

NCKAP5L Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
SCG3 AAV Vector (Mouse) (CMV)
43146104 1 µg

SCG3 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Anti-Cyclophilin A Antibody, Rabbit Polyclonal
MBS8103411-01 0.1 mL

Anti-Cyclophilin A Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details