Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLAMF2/CD48, Rat (HEK293, His)

SLAMF2/CD48 is a GPI-anchored glycoprotein that regulates immune cells. It interacts with receptors like CD2 and CD244/2B4, activating LCK and LAT in T-cell signaling. SLAMF2 also phosphorylates CD244, leading to immunological synapse formation and targeted release of cytolytic granules by T-lymphocytes and NK-cells. Its direct interactions with CD2, CD244, and LCK contribute to immune response regulation. SLAMF2/CD48 Protein, Rat (HEK293, His) is the recombinant rat-derived SLAMF2/CD48 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

SLAMF2/CD48 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/slamf2-cd48-protein-rat-hek293-his.html

Purity

98.00

Smiles

FQDQSVPNVNAITGSNVTLTILKHPLASYQRLTWLHTTNQKILEYFPNGKKTVFESVFKDRVDLDKTNGALRIYNVSKEDRGDYYMRMLHETEDQWKITMEVYDLVSKPAIKIEKTKNLTDSCHLRLSCKVEDQGVDYTWYEDSGPFPQRNPGYVLEITITPHNKSTFYTCQVSNPVSSENDTLYFIPPCTLAR

Molecular Formula

245962 (Gene_ID) P10252 (F23-R216) (Accession)

Molecular Weight

Approximately 32-50 kDa 32-50 kDa in SDS-PAGE under reducing conditions due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NATtrol T.vaginalis Positive Control
NATTVPOS-6MC 6x 1.2 mL

NATtrol T.vaginalis Positive Control

Sign In for Pricing
View Details
Rabbit Monoclonal EMMPRIN/CD147 Antibody (BSG/9290R) [Alexa Fluor 647]
NBP3-24073AF647 0.1 mL

Rabbit Monoclonal EMMPRIN/CD147 Antibody (BSG/9290R) [Alexa Fluor 647]

Sign In for Pricing
View Details
SHMT2 Mouse Monoclonal Antibody [Clone ID: LBI5H10]
AMM18627VCF 100 µg

SHMT2 Mouse Monoclonal Antibody [Clone ID: LBI5H10]

Sign In for Pricing
View Details
Phyhip sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4043403 1.0 µg DNA

Phyhip sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
XPB (ERCC3) (NM_000122) Human Tagged Lenti ORF Clone
RC202425L4 10 µg

XPB (ERCC3) (NM_000122) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mouse MAN1A1 siRNA
abx923369-01 15 nmol

Mouse MAN1A1 siRNA

Sign In for Pricing
View Details