Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vaccinia virus B5R (B5R)

Product Specifications

Abbreviation

Recombinant Vaccinia virus B5R protein

Gene Name

B5R

UniProt

Q80KX4

Expression Region

1-317aa

Organism

Vaccinia virus

Target Sequence

MKTISVVTLLCVLPAVVYSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSLDPNAVCETDKWKYENPCKKMCTVSDYVSELYDKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYITINCDVGYEVIGASYISCTANSWNVIPSCQQKCDMPSLSNGLISGSTFSIGGVIHLSCKSGFILTGSPSSTCIDGKWNPILPTCVRSNKEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYHIIIVALTIMGVIFLISVIVLVCSCDKNNDQYKFHKLLP

Tag

N-terminal 10xHis-tagged

Type

CF Transmembrane Protein & In Stock Protein

Source

In vitro E.coli expression system

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

41.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 (ICAM-3) (186-2G9), CF568 conjugate, 0.1mg/mL
BNC680178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF405S conjugate, 0.1mg/mL
BNC041052-100 1x 100 µL

CD3e (B-B12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF568 conjugate, 0.1mg/mL
BNC680146-100 1x 100 µL

CD10 (CB-CALLA), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF594 conjugate, 0.1mg/mL
BNC940050-500 1x 500 µL

IgA Secretory Component (SC05), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF488A conjugate, 0.1mg/mL
BNC880645-100 1x 100 µL

FOXP3 (3G3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF647 conjugate, 0.1mg/mL
BNC472853-100 1x 100 µL

CD54 / ICAM-1 (15.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details