Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REG-3 alpha/REG3A, Mouse (HEK293, His)

REG-3 α/REG3A proteins exhibit identical protein-binding, oligosaccharide-binding, and peptidoglycan-binding activities.It negatively regulates keratinocyte differentiation and positively regulates keratinocyte proliferation and wound healing, emphasizing its role in skin-related processes.REG-3 alpha/REG3A Protein, Mouse (HEK293, His) is the recombinant mouse-derived REG-3 alpha/REG3A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

REG-3 alpha/REG3A Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/reg3a-protein-mouse-hek293-his.html

Purity

98.0

Smiles

EDFQKEVPSPRTSCPMGYKAYRSHCYALVMTPKSWFQADLVCQKRPSGHLVSILSGGEASFVSSLVNGRVDNYQDIWIGLHDPTMGQQPNGGGWEWSNSDVLNYLNWDGDPSSTVNRGHCGSLTASSGFLKWGDYYCDGTLPFVCKFKQ

Molecular Formula

19694 (Gene_ID) NP_035389 (E27-Q175) (Accession)

Molecular Weight

Approximately 18 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal PLK1 Antibody (AZ44) [DyLight 680]
NB100-2747FR 0.1 mL

Mouse Monoclonal PLK1 Antibody (AZ44) [DyLight 680]

Sign In for Pricing
View Details
BFSP2 Protein Vector (Mouse) (pPM-C-HA)
PV159352 500 ng

BFSP2 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Sapporo virus Capsid Protein (N-His, Sapporo virus)
P508032 100 µg

Sapporo virus Capsid Protein (N-His, Sapporo virus)

Sign In for Pricing
View Details
Plectin Recombinant Antibody, AbBy Fluor™ 647 Conjugated
bsm-61118R-BF647-01 20 µL

Plectin Recombinant Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Plectin Recombinant Antibody, AbBy Fluor™ 647 Conjugated
bsm-61118R-BF647-02 100 µL

Plectin Recombinant Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O8 (strain IAI1) RNB Polyclonal Antibody
MBS7139152 Inquire

Rabbit anti-Escherichia coli O8 (strain IAI1) RNB Polyclonal Antibody

Sign In for Pricing
View Details