Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REG-3 alpha/REG3A, Mouse (HEK293, His)

REG-3 α/REG3A proteins exhibit identical protein-binding, oligosaccharide-binding, and peptidoglycan-binding activities.It negatively regulates keratinocyte differentiation and positively regulates keratinocyte proliferation and wound healing, emphasizing its role in skin-related processes.REG-3 alpha/REG3A Protein, Mouse (HEK293, His) is the recombinant mouse-derived REG-3 alpha/REG3A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

REG-3 alpha/REG3A Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/reg3a-protein-mouse-hek293-his.html

Purity

98.0

Smiles

EDFQKEVPSPRTSCPMGYKAYRSHCYALVMTPKSWFQADLVCQKRPSGHLVSILSGGEASFVSSLVNGRVDNYQDIWIGLHDPTMGQQPNGGGWEWSNSDVLNYLNWDGDPSSTVNRGHCGSLTASSGFLKWGDYYCDGTLPFVCKFKQ

Molecular Formula

19694 (Gene_ID) NP_035389 (E27-Q175) (Accession)

Molecular Weight

Approximately 18 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Itm2a Mouse shRNA Plasmid (Locus ID 16431)
TR501127 1 Kit

Itm2a Mouse shRNA Plasmid (Locus ID 16431)

Sign In for Pricing
View Details
HBQ1 Antibody
ABD10164 100 µg

HBQ1 Antibody

Sign In for Pricing
View Details
CD32 (FCGR2A, FCG2, FCGR2A1, IGFR2, Low Affinity Immunoglobulin gamma Fc Region Receptor II-a, CDw32, Fc-gamma RII-a) (PE)
367073-01 25 Tests

CD32 (FCGR2A, FCG2, FCGR2A1, IGFR2, Low Affinity Immunoglobulin gamma Fc Region Receptor II-a, CDw32, Fc-gamma RII-a) (PE)

Sign In for Pricing
View Details
CD32 (FCGR2A, FCG2, FCGR2A1, IGFR2, Low Affinity Immunoglobulin gamma Fc Region Receptor II-a, CDw32, Fc-gamma RII-a) (PE)
367073-02 100 Tests

CD32 (FCGR2A, FCG2, FCGR2A1, IGFR2, Low Affinity Immunoglobulin gamma Fc Region Receptor II-a, CDw32, Fc-gamma RII-a) (PE)

Sign In for Pricing
View Details
CD32 (FCGR2A, FCG2, FCGR2A1, IGFR2, Low Affinity Immunoglobulin gamma Fc Region Receptor II-a, CDw32, Fc-gamma RII-a) (PE)
367073-03 200 Tests

CD32 (FCGR2A, FCG2, FCGR2A1, IGFR2, Low Affinity Immunoglobulin gamma Fc Region Receptor II-a, CDw32, Fc-gamma RII-a) (PE)

Sign In for Pricing
View Details
PO mgNT2 Antibody
E38QA5535 100 µL

PO mgNT2 Antibody

Sign In for Pricing
View Details