Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REG-3 alpha/REG3A, Mouse (HEK293, His)

REG-3 α/REG3A proteins exhibit identical protein-binding, oligosaccharide-binding, and peptidoglycan-binding activities.It negatively regulates keratinocyte differentiation and positively regulates keratinocyte proliferation and wound healing, emphasizing its role in skin-related processes.REG-3 alpha/REG3A Protein, Mouse (HEK293, His) is the recombinant mouse-derived REG-3 alpha/REG3A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

REG-3 alpha/REG3A Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/reg3a-protein-mouse-hek293-his.html

Purity

98.0

Smiles

EDFQKEVPSPRTSCPMGYKAYRSHCYALVMTPKSWFQADLVCQKRPSGHLVSILSGGEASFVSSLVNGRVDNYQDIWIGLHDPTMGQQPNGGGWEWSNSDVLNYLNWDGDPSSTVNRGHCGSLTASSGFLKWGDYYCDGTLPFVCKFKQ

Molecular Formula

19694 (Gene_ID) NP_035389 (E27-Q175) (Accession)

Molecular Weight

Approximately 18 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GBF1 (KIAA0248) discontinued
509744 100 µg

GBF1 (KIAA0248) discontinued

Sign In for Pricing
View Details
MMP19, NT (MMP19, MMP18, RASI, Matrix metalloproteinase-19, Matrix metalloproteinase RASI, Matrix metalloproteinase-18) (MaxLight 550) discontinued
038506-ML550 100 µL

MMP19, NT (MMP19, MMP18, RASI, Matrix metalloproteinase-19, Matrix metalloproteinase RASI, Matrix metalloproteinase-18) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal alpha Tubulin Antibody (961258) [Biotin]
MAB93441B 100 µL

Mouse Monoclonal alpha Tubulin Antibody (961258) [Biotin]

Sign In for Pricing
View Details
TRDC, ID (TRDC, T-cell receptor delta chain C region) (MaxLight 405) discontinued
043199-ML405 100 µL

TRDC, ID (TRDC, T-cell receptor delta chain C region) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Triton X-100
GD6826-500ML 500 mL

Triton X-100

Sign In for Pricing
View Details
Rabbi! anti-DDX42 Antibody, Affinity Purified
A303-354A 100 µg

Rabbi! anti-DDX42 Antibody, Affinity Purified

Sign In for Pricing
View Details