Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REG-3 alpha/REG3A, Mouse (HEK293, His)

REG-3 α/REG3A proteins exhibit identical protein-binding, oligosaccharide-binding, and peptidoglycan-binding activities.It negatively regulates keratinocyte differentiation and positively regulates keratinocyte proliferation and wound healing, emphasizing its role in skin-related processes.REG-3 alpha/REG3A Protein, Mouse (HEK293, His) is the recombinant mouse-derived REG-3 alpha/REG3A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

REG-3 alpha/REG3A Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/reg3a-protein-mouse-hek293-his.html

Purity

98.0

Smiles

EDFQKEVPSPRTSCPMGYKAYRSHCYALVMTPKSWFQADLVCQKRPSGHLVSILSGGEASFVSSLVNGRVDNYQDIWIGLHDPTMGQQPNGGGWEWSNSDVLNYLNWDGDPSSTVNRGHCGSLTASSGFLKWGDYYCDGTLPFVCKFKQ

Molecular Formula

19694 (Gene_ID) NP_035389 (E27-Q175) (Accession)

Molecular Weight

Approximately 18 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine D-lactic acid ELISA Kit
EIA07351p 1 Kit

Porcine D-lactic acid ELISA Kit

Sign In for Pricing
View Details
PINK1 Antibody
E10-31734 100 µL

PINK1 Antibody

Sign In for Pricing
View Details
2-Chloro-n- (3-chlorophenyl) acetamide
417098-01 500 mg

2-Chloro-n- (3-chlorophenyl) acetamide

Sign In for Pricing
View Details
2-Chloro-n- (3-chlorophenyl) acetamide
417098-02 1 g

2-Chloro-n- (3-chlorophenyl) acetamide

Sign In for Pricing
View Details
Vmn1r196 Protein Lysate (Mouse) with C-HA Tag
49600034 100 µg

Vmn1r196 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
BT3A2, CT (Butyrophilin subfamily 3 member A2, BTF4, BTF3, BT3.2, BTN3A2) (APC)
MBS6279089-01 0.2 mL

BT3A2, CT (Butyrophilin subfamily 3 member A2, BTF4, BTF3, BT3.2, BTN3A2) (APC)

Sign In for Pricing
View Details