REG-3 alpha/REG3A, Mouse (HEK293, His)
REG-3 α/REG3A proteins exhibit identical protein-binding, oligosaccharide-binding, and peptidoglycan-binding activities.It negatively regulates keratinocyte differentiation and positively regulates keratinocyte proliferation and wound healing, emphasizing its role in skin-related processes.REG-3 alpha/REG3A Protein, Mouse (HEK293, His) is the recombinant mouse-derived REG-3 alpha/REG3A protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
REG-3 alpha/REG3A Protein, Mouse (HEK293, His), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/reg3a-protein-mouse-hek293-his.html
Purity
98.0
Smiles
EDFQKEVPSPRTSCPMGYKAYRSHCYALVMTPKSWFQADLVCQKRPSGHLVSILSGGEASFVSSLVNGRVDNYQDIWIGLHDPTMGQQPNGGGWEWSNSDVLNYLNWDGDPSSTVNRGHCGSLTASSGFLKWGDYYCDGTLPFVCKFKQ
Molecular Formula
19694 (Gene_ID) NP_035389 (E27-Q175) (Accession)
Molecular Weight
Approximately 18 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
Recombinant Shigella Boydii ybiA Protein (aa 1-160)
TCF 1 (Transcription Factor 1, TCF1, TCF-1, Hepatocyte Nuclear Factor 1-alpha, HNF-1-alpha, HNF1A, HNF-1A, HNF1, IDDM20, Liver-specific Transcription Factor LF-B1, LFB1, MODY3) (AP)
TCF 1 (Transcription Factor 1, TCF1, TCF-1, Hepatocyte Nuclear Factor 1-alpha, HNF-1-alpha, HNF1A, HNF-1A, HNF1, IDDM20, Liver-specific Transcription Factor LF-B1, LFB1, MODY3) (AP)