Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REG-3 alpha/REG3A, Mouse (HEK293, His)

REG-3 α/REG3A proteins exhibit identical protein-binding, oligosaccharide-binding, and peptidoglycan-binding activities.It negatively regulates keratinocyte differentiation and positively regulates keratinocyte proliferation and wound healing, emphasizing its role in skin-related processes.REG-3 alpha/REG3A Protein, Mouse (HEK293, His) is the recombinant mouse-derived REG-3 alpha/REG3A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

REG-3 alpha/REG3A Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/reg3a-protein-mouse-hek293-his.html

Purity

98.0

Smiles

EDFQKEVPSPRTSCPMGYKAYRSHCYALVMTPKSWFQADLVCQKRPSGHLVSILSGGEASFVSSLVNGRVDNYQDIWIGLHDPTMGQQPNGGGWEWSNSDVLNYLNWDGDPSSTVNRGHCGSLTASSGFLKWGDYYCDGTLPFVCKFKQ

Molecular Formula

19694 (Gene_ID) NP_035389 (E27-Q175) (Accession)

Molecular Weight

Approximately 18 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Jagged 1 Antibody
3101-30T 30 µg

Jagged 1 Antibody

Sign In for Pricing
View Details
MOSC2 (MARC2) Human Gene Knockout Kit (CRISPR)
KN403877 1 Kit

MOSC2 (MARC2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PSMC3IP (NM_001256015) Human Untagged Clone
SC332281 10 µg

PSMC3IP (NM_001256015) Human Untagged Clone

Sign In for Pricing
View Details
TCP-10b (m) -PR
sc-154141-PR 10 µM - 20 µL

TCP-10b (m) -PR

Sign In for Pricing
View Details
Mouse Monoclonal MRP1 Antibody (464510) [Biotin]
FAB1929B 0.1 mL

Mouse Monoclonal MRP1 Antibody (464510) [Biotin]

Sign In for Pricing
View Details
RND3 Antibody
MBS8500359-01 0.1 mg

RND3 Antibody

Sign In for Pricing
View Details