Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REG-3 alpha/REG3A, Mouse (HEK293, His)

REG-3 α/REG3A proteins exhibit identical protein-binding, oligosaccharide-binding, and peptidoglycan-binding activities.It negatively regulates keratinocyte differentiation and positively regulates keratinocyte proliferation and wound healing, emphasizing its role in skin-related processes.REG-3 alpha/REG3A Protein, Mouse (HEK293, His) is the recombinant mouse-derived REG-3 alpha/REG3A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

REG-3 alpha/REG3A Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/reg3a-protein-mouse-hek293-his.html

Purity

98.0

Smiles

EDFQKEVPSPRTSCPMGYKAYRSHCYALVMTPKSWFQADLVCQKRPSGHLVSILSGGEASFVSSLVNGRVDNYQDIWIGLHDPTMGQQPNGGGWEWSNSDVLNYLNWDGDPSSTVNRGHCGSLTASSGFLKWGDYYCDGTLPFVCKFKQ

Molecular Formula

19694 (Gene_ID) NP_035389 (E27-Q175) (Accession)

Molecular Weight

Approximately 18 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Periodontal Ligament Stem Cells
RPC-775 5x 10^5

Rabbit Periodontal Ligament Stem Cells

Sign In for Pricing
View Details
Lentiviral mouse Ppef2 shRNA (UAS) - Lentiviral mouse Ppef2 shRNA (UAS, GFP) (100)
GTR15285165 1 Vial

Lentiviral mouse Ppef2 shRNA (UAS) - Lentiviral mouse Ppef2 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Vill siRNA Oligos set (Rat)
49501176 3x 5 nmol

Vill siRNA Oligos set (Rat)

Sign In for Pricing
View Details
PF4V1 (NM_002620) Human Recombinant Protein
PH34769M5 20 µg

PF4V1 (NM_002620) Human Recombinant Protein

Sign In for Pricing
View Details
Anti-Listeria monocytogenes serovar 1/2a InlB/Internalin B Antibody (SAA0363)
RXX07701 100 μg

Anti-Listeria monocytogenes serovar 1/2a InlB/Internalin B Antibody (SAA0363)

Sign In for Pricing
View Details
Cy3 Linked Monoclonal Antibody to Wingless Type MMTV Integration Site Family, Member 4 (WNT4)
MBS2137868-01 0.1 mL

Cy3 Linked Monoclonal Antibody to Wingless Type MMTV Integration Site Family, Member 4 (WNT4)

Sign In for Pricing
View Details