Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REG-3 alpha/REG3A, Mouse (HEK293, His)

REG-3 α/REG3A proteins exhibit identical protein-binding, oligosaccharide-binding, and peptidoglycan-binding activities.It negatively regulates keratinocyte differentiation and positively regulates keratinocyte proliferation and wound healing, emphasizing its role in skin-related processes.REG-3 alpha/REG3A Protein, Mouse (HEK293, His) is the recombinant mouse-derived REG-3 alpha/REG3A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

REG-3 alpha/REG3A Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/reg3a-protein-mouse-hek293-his.html

Purity

98.0

Smiles

EDFQKEVPSPRTSCPMGYKAYRSHCYALVMTPKSWFQADLVCQKRPSGHLVSILSGGEASFVSSLVNGRVDNYQDIWIGLHDPTMGQQPNGGGWEWSNSDVLNYLNWDGDPSSTVNRGHCGSLTASSGFLKWGDYYCDGTLPFVCKFKQ

Molecular Formula

19694 (Gene_ID) NP_035389 (E27-Q175) (Accession)

Molecular Weight

Approximately 18 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse VTN/Vitronectin Protein, N-His
MY209012-01 50 µg

Recombinant Mouse VTN/Vitronectin Protein, N-His

Sign In for Pricing
View Details
Recombinant Mouse VTN/Vitronectin Protein, N-His
MY209012-02 100 µg

Recombinant Mouse VTN/Vitronectin Protein, N-His

Sign In for Pricing
View Details
Recombinant Mouse VTN/Vitronectin Protein, N-His
MY209012-03 1 mg

Recombinant Mouse VTN/Vitronectin Protein, N-His

Sign In for Pricing
View Details
Lentiviral mouse Gatc shRNA (UAS) - Lentiviral mouse Gatc shRNA (UAS) plasmid
GTR15303430 1 Vial

Lentiviral mouse Gatc shRNA (UAS) - Lentiviral mouse Gatc shRNA (UAS) plasmid

Sign In for Pricing
View Details
Lentiviral human RPTOR shRNA (UAS) - Lentiviral human RPTOR shRNA (UAS, RFP) plasmid
GTR15098917 1 Vial

Lentiviral human RPTOR shRNA (UAS) - Lentiviral human RPTOR shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Recombinant Human Procalcitonin Protein, Untagged, E.coli-1mg
QP10847-1mg 1mg

Recombinant Human Procalcitonin Protein, Untagged, E.coli-1mg

Sign In for Pricing
View Details