Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REG-3 alpha/REG3A, Mouse (HEK293, His)

REG-3 α/REG3A proteins exhibit identical protein-binding, oligosaccharide-binding, and peptidoglycan-binding activities.It negatively regulates keratinocyte differentiation and positively regulates keratinocyte proliferation and wound healing, emphasizing its role in skin-related processes.REG-3 alpha/REG3A Protein, Mouse (HEK293, His) is the recombinant mouse-derived REG-3 alpha/REG3A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

REG-3 alpha/REG3A Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/reg3a-protein-mouse-hek293-his.html

Purity

98.0

Smiles

EDFQKEVPSPRTSCPMGYKAYRSHCYALVMTPKSWFQADLVCQKRPSGHLVSILSGGEASFVSSLVNGRVDNYQDIWIGLHDPTMGQQPNGGGWEWSNSDVLNYLNWDGDPSSTVNRGHCGSLTASSGFLKWGDYYCDGTLPFVCKFKQ

Molecular Formula

19694 (Gene_ID) NP_035389 (E27-Q175) (Accession)

Molecular Weight

Approximately 18 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIAA0895 (NM_001199706) Human Untagged Clone
SC331349 10 µg

KIAA0895 (NM_001199706) Human Untagged Clone

Sign In for Pricing
View Details
Mouse Interleukin 20 (IL20) ELISA Kit
RDR-IL20-Mu-48Tests 48 Tests

Mouse Interleukin 20 (IL20) ELISA Kit

Sign In for Pricing
View Details
ZFAND5 Adenovirus (Rat)
50822056 1.0 mL

ZFAND5 Adenovirus (Rat)

Sign In for Pricing
View Details
KCNH1 (EAG, EAG1, Potassium voltage-gated channel subfamily H member 1, Ether-a-go-go potassium channel 1, EAG channel 1, h-eag, hEAG1, Voltage-gated potassium channel subunit Kv10.1)
321445 100 µL

KCNH1 (EAG, EAG1, Potassium voltage-gated channel subfamily H member 1, Ether-a-go-go potassium channel 1, EAG channel 1, h-eag, hEAG1, Voltage-gated potassium channel subunit Kv10.1)

Sign In for Pricing
View Details
Mouse Monoclonal CREB5 Antibody (PCRP-CREB5-1G8) [DyLight 550]
NBP3-14073R 0.1 mL

Mouse Monoclonal CREB5 Antibody (PCRP-CREB5-1G8) [DyLight 550]

Sign In for Pricing
View Details
MEST Antibody
MBS7046557-01 0.05 mL

MEST Antibody

Sign In for Pricing
View Details