Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REG-3 alpha/REG3A, Mouse (HEK293, His)

REG-3 α/REG3A proteins exhibit identical protein-binding, oligosaccharide-binding, and peptidoglycan-binding activities.It negatively regulates keratinocyte differentiation and positively regulates keratinocyte proliferation and wound healing, emphasizing its role in skin-related processes.REG-3 alpha/REG3A Protein, Mouse (HEK293, His) is the recombinant mouse-derived REG-3 alpha/REG3A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

REG-3 alpha/REG3A Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/reg3a-protein-mouse-hek293-his.html

Purity

98.0

Smiles

EDFQKEVPSPRTSCPMGYKAYRSHCYALVMTPKSWFQADLVCQKRPSGHLVSILSGGEASFVSSLVNGRVDNYQDIWIGLHDPTMGQQPNGGGWEWSNSDVLNYLNWDGDPSSTVNRGHCGSLTASSGFLKWGDYYCDGTLPFVCKFKQ

Molecular Formula

19694 (Gene_ID) NP_035389 (E27-Q175) (Accession)

Molecular Weight

Approximately 18 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGS10 antibody
70R-1242 100 ug

RGS10 antibody

Sign In for Pricing
View Details
Human FGFR1 knockout cell line
ABC-KH5530 1 Vial

Human FGFR1 knockout cell line

Sign In for Pricing
View Details
Flexible Tube Tygon® A24, ID = 12.7 mm, OD = 19.05 mm, made of thermoplastic elastomer
1462264 Package of 1 m

Flexible Tube Tygon® A24, ID = 12.7 mm, OD = 19.05 mm, made of thermoplastic elastomer

Sign In for Pricing
View Details
FURIN (Furin (Paired Basic Amino Acid Cleaving Enzyme)
481414 100 µL

FURIN (Furin (Paired Basic Amino Acid Cleaving Enzyme)

Sign In for Pricing
View Details
Ecsit Rat siRNA Oligo Duplex (Locus ID 300447)
SR508847 1 Kit

Ecsit Rat siRNA Oligo Duplex (Locus ID 300447)

Sign In for Pricing
View Details
ZBTB40 (Zinc Finger and BTB Domain containing 40, ZNF923) discontinued
346535-01 100 µL

ZBTB40 (Zinc Finger and BTB Domain containing 40, ZNF923) discontinued

Sign In for Pricing
View Details