Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REG-3 alpha/REG3A, Mouse (HEK293, His)

REG-3 α/REG3A proteins exhibit identical protein-binding, oligosaccharide-binding, and peptidoglycan-binding activities.It negatively regulates keratinocyte differentiation and positively regulates keratinocyte proliferation and wound healing, emphasizing its role in skin-related processes.REG-3 alpha/REG3A Protein, Mouse (HEK293, His) is the recombinant mouse-derived REG-3 alpha/REG3A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

REG-3 alpha/REG3A Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/reg3a-protein-mouse-hek293-his.html

Purity

98.0

Smiles

EDFQKEVPSPRTSCPMGYKAYRSHCYALVMTPKSWFQADLVCQKRPSGHLVSILSGGEASFVSSLVNGRVDNYQDIWIGLHDPTMGQQPNGGGWEWSNSDVLNYLNWDGDPSSTVNRGHCGSLTASSGFLKWGDYYCDGTLPFVCKFKQ

Molecular Formula

19694 (Gene_ID) NP_035389 (E27-Q175) (Accession)

Molecular Weight

Approximately 18 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dlat (NM_145614) Mouse Tagged Lenti ORF Clone
MR209711L3 10 µg

Dlat (NM_145614) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Anti-RPL28 antibody
PAab07428 100 µg

Anti-RPL28 antibody

Sign In for Pricing
View Details
UTY Antibody, HRP conjugated
A38203-100UG 100 µg

UTY Antibody, HRP conjugated

Sign In for Pricing
View Details
Human Thyroid Hormone Receptor Interactor 6 (TRIP6) ELISA Kit
RDR-TRIP6-Hu-96Tests 96 Tests

Human Thyroid Hormone Receptor Interactor 6 (TRIP6) ELISA Kit

Sign In for Pricing
View Details
Bles03 Protein Vector (Rat) (pPM-C-His)
PV256301 500 ng

Bles03 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
CXADR (NM_001207065) Human Tagged ORF Clone
RC231600 10 µg

CXADR (NM_001207065) Human Tagged ORF Clone

Sign In for Pricing
View Details