Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REG-3 alpha/REG3A, Mouse (HEK293, His)

REG-3 α/REG3A proteins exhibit identical protein-binding, oligosaccharide-binding, and peptidoglycan-binding activities.It negatively regulates keratinocyte differentiation and positively regulates keratinocyte proliferation and wound healing, emphasizing its role in skin-related processes.REG-3 alpha/REG3A Protein, Mouse (HEK293, His) is the recombinant mouse-derived REG-3 alpha/REG3A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

REG-3 alpha/REG3A Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/reg3a-protein-mouse-hek293-his.html

Purity

98.0

Smiles

EDFQKEVPSPRTSCPMGYKAYRSHCYALVMTPKSWFQADLVCQKRPSGHLVSILSGGEASFVSSLVNGRVDNYQDIWIGLHDPTMGQQPNGGGWEWSNSDVLNYLNWDGDPSSTVNRGHCGSLTASSGFLKWGDYYCDGTLPFVCKFKQ

Molecular Formula

19694 (Gene_ID) NP_035389 (E27-Q175) (Accession)

Molecular Weight

Approximately 18 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IVD Rabbit Polyclonal Antibody
MBS9513039-01 0.05 mL

IVD Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IVD Rabbit Polyclonal Antibody
MBS9513039-02 0.1 mL

IVD Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IVD Rabbit Polyclonal Antibody
MBS9513039-03 5x 0.1 mL

IVD Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DMC1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV709336 1.0 µg DNA

DMC1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Lentiviral human C6orf226 shRNA (UAS) - Lentiviral human C6orf226 shRNA (UAS, RFP) plasmid
GTR15107581 1 Vial

Lentiviral human C6orf226 shRNA (UAS) - Lentiviral human C6orf226 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Rabbit anti-Drosophila melanogaster (Fruit fly) TINC Polyclonal Antibody
MBS7199723 Inquire

Rabbit anti-Drosophila melanogaster (Fruit fly) TINC Polyclonal Antibody

Sign In for Pricing
View Details