REG-3 alpha/REG3A, Mouse (HEK293, His)
REG-3 α/REG3A proteins exhibit identical protein-binding, oligosaccharide-binding, and peptidoglycan-binding activities.It negatively regulates keratinocyte differentiation and positively regulates keratinocyte proliferation and wound healing, emphasizing its role in skin-related processes.REG-3 alpha/REG3A Protein, Mouse (HEK293, His) is the recombinant mouse-derived REG-3 alpha/REG3A protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
REG-3 alpha/REG3A Protein, Mouse (HEK293, His), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/reg3a-protein-mouse-hek293-his.html
Purity
98.0
Smiles
EDFQKEVPSPRTSCPMGYKAYRSHCYALVMTPKSWFQADLVCQKRPSGHLVSILSGGEASFVSSLVNGRVDNYQDIWIGLHDPTMGQQPNGGGWEWSNSDVLNYLNWDGDPSSTVNRGHCGSLTASSGFLKWGDYYCDGTLPFVCKFKQ
Molecular Formula
19694 (Gene_ID) NP_035389 (E27-Q175) (Accession)
Molecular Weight
Approximately 18 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
RPS6KB1 (Ser404) (Ribosomal Protein S6 Kinase beta-1, S6K-beta-1, S6K1, 70kD Ribosomal Protein S6 Kinase 1, P70S6K1, p70-S6K 1, p70 Ribosomal S6 Kinase alpha, p70 S6 Kinase alpha, p70 S6K-alpha, p70 S6KA, p70-S6K, Ribosomal Protein S6 Kinase I, Serine/threonine-protein Kinase 14A, STK14A) (MaxLight 405) discontinued
Cow Vasopressin-neurophysin 2-copeptin (AVP) ELISA Kit