Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REG-3 alpha/REG3A, Mouse (HEK293, His)

REG-3 α/REG3A proteins exhibit identical protein-binding, oligosaccharide-binding, and peptidoglycan-binding activities.It negatively regulates keratinocyte differentiation and positively regulates keratinocyte proliferation and wound healing, emphasizing its role in skin-related processes.REG-3 alpha/REG3A Protein, Mouse (HEK293, His) is the recombinant mouse-derived REG-3 alpha/REG3A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

REG-3 alpha/REG3A Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/reg3a-protein-mouse-hek293-his.html

Purity

98.0

Smiles

EDFQKEVPSPRTSCPMGYKAYRSHCYALVMTPKSWFQADLVCQKRPSGHLVSILSGGEASFVSSLVNGRVDNYQDIWIGLHDPTMGQQPNGGGWEWSNSDVLNYLNWDGDPSSTVNRGHCGSLTASSGFLKWGDYYCDGTLPFVCKFKQ

Molecular Formula

19694 (Gene_ID) NP_035389 (E27-Q175) (Accession)

Molecular Weight

Approximately 18 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Caspase 5 Antibody [mFluor Violet 610 SE]
NBP2-98202MFV610 0.1 mL

Rabbit Polyclonal Caspase 5 Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details
SP2 transcription factor (SP2) CytoSection
TS407602P5 25 Slides

SP2 transcription factor (SP2) CytoSection

Sign In for Pricing
View Details
GBX2 (Gastrulation Brain Homeobox 2) (HRP)
246512-HRP 100 µL

GBX2 (Gastrulation Brain Homeobox 2) (HRP)

Sign In for Pricing
View Details
Mmu-miR-6912-3p miRNA Agomir
CMN1292-01 5 nmol

Mmu-miR-6912-3p miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-6912-3p miRNA Agomir
CMN1292-02 10 nmol

Mmu-miR-6912-3p miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-6912-3p miRNA Agomir
CMN1292-03 20 nmol

Mmu-miR-6912-3p miRNA Agomir

Sign In for Pricing
View Details