Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REG-3 alpha/REG3A, Mouse (HEK293, His)

REG-3 α/REG3A proteins exhibit identical protein-binding, oligosaccharide-binding, and peptidoglycan-binding activities.It negatively regulates keratinocyte differentiation and positively regulates keratinocyte proliferation and wound healing, emphasizing its role in skin-related processes.REG-3 alpha/REG3A Protein, Mouse (HEK293, His) is the recombinant mouse-derived REG-3 alpha/REG3A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

REG-3 alpha/REG3A Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/reg3a-protein-mouse-hek293-his.html

Purity

98.0

Smiles

EDFQKEVPSPRTSCPMGYKAYRSHCYALVMTPKSWFQADLVCQKRPSGHLVSILSGGEASFVSSLVNGRVDNYQDIWIGLHDPTMGQQPNGGGWEWSNSDVLNYLNWDGDPSSTVNRGHCGSLTASSGFLKWGDYYCDGTLPFVCKFKQ

Molecular Formula

19694 (Gene_ID) NP_035389 (E27-Q175) (Accession)

Molecular Weight

Approximately 18 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

VCAM1 Antibody
A38260-100UG 100 µg

VCAM1 Antibody

Sign In for Pricing
View Details
C6orf203 (MTRES1) (NM_001142468) Human Tagged Lenti ORF Clone
RC227081L4 10 µg

C6orf203 (MTRES1) (NM_001142468) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit Polyclonal gamma Tubulin Antibody [Alexa Fluor 647]
NBP2-99067AF647 0.1 mL

Rabbit Polyclonal gamma Tubulin Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
SUV420H1 Protein Vector (Mouse) (pPB-C-His)
PV235402 500 ng

SUV420H1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
pLVshRNA-EGFP(2A)Puro-LATS1-shRNA3 Plasmid
PVT30948 2 µg

pLVshRNA-EGFP(2A)Puro-LATS1-shRNA3 Plasmid

Sign In for Pricing
View Details
Calreticulin antibody (FITC)
60R-1446 100 ug

Calreticulin antibody (FITC)

Sign In for Pricing
View Details