Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REG-3 alpha/REG3A, Mouse (HEK293, His)

REG-3 α/REG3A proteins exhibit identical protein-binding, oligosaccharide-binding, and peptidoglycan-binding activities.It negatively regulates keratinocyte differentiation and positively regulates keratinocyte proliferation and wound healing, emphasizing its role in skin-related processes.REG-3 alpha/REG3A Protein, Mouse (HEK293, His) is the recombinant mouse-derived REG-3 alpha/REG3A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

REG-3 alpha/REG3A Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/reg3a-protein-mouse-hek293-his.html

Purity

98.0

Smiles

EDFQKEVPSPRTSCPMGYKAYRSHCYALVMTPKSWFQADLVCQKRPSGHLVSILSGGEASFVSSLVNGRVDNYQDIWIGLHDPTMGQQPNGGGWEWSNSDVLNYLNWDGDPSSTVNRGHCGSLTASSGFLKWGDYYCDGTLPFVCKFKQ

Molecular Formula

19694 (Gene_ID) NP_035389 (E27-Q175) (Accession)

Molecular Weight

Approximately 18 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCML1 discontinued
513981 100 µg

SCML1 discontinued

Sign In for Pricing
View Details
ELISA kit for Rat PKC? (Protein Kinase C?)
E-EL-R2493 96 Tests

ELISA kit for Rat PKC? (Protein Kinase C?)

Sign In for Pricing
View Details
Protein Phosphatase 4C mouse mAb
RA11900-01 50 µL

Protein Phosphatase 4C mouse mAb

Sign In for Pricing
View Details
Protein Phosphatase 4C mouse mAb
RA11900-02 100 µL

Protein Phosphatase 4C mouse mAb

Sign In for Pricing
View Details
Rabbit Angiotensin 1,ANG I ELISA KIT
JOT-EK0402Rb 96 wells

Rabbit Angiotensin 1,ANG I ELISA KIT

Sign In for Pricing
View Details
Rabbit Polyclonal DCUN1D2 Antibody [mFluor Violet 500 SE]
NBP2-97034MFV500 0.1 mL

Rabbit Polyclonal DCUN1D2 Antibody [mFluor Violet 500 SE]

Sign In for Pricing
View Details