Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REG-3 alpha/REG3A, Mouse (HEK293, His)

REG-3 α/REG3A proteins exhibit identical protein-binding, oligosaccharide-binding, and peptidoglycan-binding activities.It negatively regulates keratinocyte differentiation and positively regulates keratinocyte proliferation and wound healing, emphasizing its role in skin-related processes.REG-3 alpha/REG3A Protein, Mouse (HEK293, His) is the recombinant mouse-derived REG-3 alpha/REG3A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

REG-3 alpha/REG3A Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/reg3a-protein-mouse-hek293-his.html

Purity

98.0

Smiles

EDFQKEVPSPRTSCPMGYKAYRSHCYALVMTPKSWFQADLVCQKRPSGHLVSILSGGEASFVSSLVNGRVDNYQDIWIGLHDPTMGQQPNGGGWEWSNSDVLNYLNWDGDPSSTVNRGHCGSLTASSGFLKWGDYYCDGTLPFVCKFKQ

Molecular Formula

19694 (Gene_ID) NP_035389 (E27-Q175) (Accession)

Molecular Weight

Approximately 18 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Bclaf3 shRNA (UAS) - Lentiviral mouse Bclaf3 shRNA (UAS, GFP) (100)
GTR15179517 1 Vial

Lentiviral mouse Bclaf3 shRNA (UAS) - Lentiviral mouse Bclaf3 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Human Integrin beta 1/CD29 Alexa Fluor 750 Antibody
FAB1778S-100UG 100 µg

Human Integrin beta 1/CD29 Alexa Fluor 750 Antibody

Sign In for Pricing
View Details
Ganc 3'UTR GFP Stable Cell Line
TU254947 1.0 mL

Ganc 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Anti-NCAM1 (Lorvotuzumab )-SPDB-DM4 ADC
ADC-W-2621 1 mg

Anti-NCAM1 (Lorvotuzumab )-SPDB-DM4 ADC

Sign In for Pricing
View Details
Boc-1,5-diaminopentane 99+% (GC)
235828-01 1 g

Boc-1,5-diaminopentane 99+% (GC)

Sign In for Pricing
View Details
Boc-1,5-diaminopentane 99+% (GC)
235828-02 5 g

Boc-1,5-diaminopentane 99+% (GC)

Sign In for Pricing
View Details