Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REG-3 alpha/REG3A, Mouse (HEK293, His)

REG-3 α/REG3A proteins exhibit identical protein-binding, oligosaccharide-binding, and peptidoglycan-binding activities.It negatively regulates keratinocyte differentiation and positively regulates keratinocyte proliferation and wound healing, emphasizing its role in skin-related processes.REG-3 alpha/REG3A Protein, Mouse (HEK293, His) is the recombinant mouse-derived REG-3 alpha/REG3A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

REG-3 alpha/REG3A Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/reg3a-protein-mouse-hek293-his.html

Purity

98.0

Smiles

EDFQKEVPSPRTSCPMGYKAYRSHCYALVMTPKSWFQADLVCQKRPSGHLVSILSGGEASFVSSLVNGRVDNYQDIWIGLHDPTMGQQPNGGGWEWSNSDVLNYLNWDGDPSSTVNRGHCGSLTASSGFLKWGDYYCDGTLPFVCKFKQ

Molecular Formula

19694 (Gene_ID) NP_035389 (E27-Q175) (Accession)

Molecular Weight

Approximately 18 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-SH2D1A antibody
SL9873R-01 50 µL

Rabbit Anti-SH2D1A antibody

Sign In for Pricing
View Details
Rabbit Anti-SH2D1A antibody
SL9873R-02 100 µL

Rabbit Anti-SH2D1A antibody

Sign In for Pricing
View Details
Dicoumarol 10mM * 1mL in DMSO
A14241-10mM-D 10 mM x 1mL in DMSO

Dicoumarol 10mM * 1mL in DMSO

Sign In for Pricing
View Details
LOC257643 3'UTR GFP Stable Cell Line
TU259819 1.0 mL

LOC257643 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Genorise® Human TNFRI Polyclonal Antibody
GR126158 100 µg

Genorise® Human TNFRI Polyclonal Antibody

Sign In for Pricing
View Details
MGC35440 (NM_153220) Human Tagged Lenti ORF Clone
RC206789L3 10 µg

MGC35440 (NM_153220) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details