Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REG-3 alpha/REG3A, Mouse (HEK293, His)

REG-3 α/REG3A proteins exhibit identical protein-binding, oligosaccharide-binding, and peptidoglycan-binding activities.It negatively regulates keratinocyte differentiation and positively regulates keratinocyte proliferation and wound healing, emphasizing its role in skin-related processes.REG-3 alpha/REG3A Protein, Mouse (HEK293, His) is the recombinant mouse-derived REG-3 alpha/REG3A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

REG-3 alpha/REG3A Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/reg3a-protein-mouse-hek293-his.html

Purity

98.0

Smiles

EDFQKEVPSPRTSCPMGYKAYRSHCYALVMTPKSWFQADLVCQKRPSGHLVSILSGGEASFVSSLVNGRVDNYQDIWIGLHDPTMGQQPNGGGWEWSNSDVLNYLNWDGDPSSTVNRGHCGSLTASSGFLKWGDYYCDGTLPFVCKFKQ

Molecular Formula

19694 (Gene_ID) NP_035389 (E27-Q175) (Accession)

Molecular Weight

Approximately 18 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CORO7 (NM_024535) Human Recombinant Protein
TP324038M 100 µg

CORO7 (NM_024535) Human Recombinant Protein

Sign In for Pricing
View Details
Staufen Double-Stranded RNA Binding Protein 2 (STAU2) Antibody
abx145674-01 100 µg

Staufen Double-Stranded RNA Binding Protein 2 (STAU2) Antibody

Sign In for Pricing
View Details
Staufen Double-Stranded RNA Binding Protein 2 (STAU2) Antibody
abx145674-02 1 mg

Staufen Double-Stranded RNA Binding Protein 2 (STAU2) Antibody

Sign In for Pricing
View Details
CTSF, Control Peptide (Cathepsin F, CATSF)
147741 100 µg

CTSF, Control Peptide (Cathepsin F, CATSF)

Sign In for Pricing
View Details
Psmb4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6858507 1.0 µg DNA

Psmb4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Atrophin 1 (ATN1)
MBS2064113-01 0.1 mL

APC-Linked Monoclonal Antibody to Atrophin 1 (ATN1)

Sign In for Pricing
View Details