Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REG-3 alpha/REG3A, Mouse (HEK293, His)

REG-3 α/REG3A proteins exhibit identical protein-binding, oligosaccharide-binding, and peptidoglycan-binding activities.It negatively regulates keratinocyte differentiation and positively regulates keratinocyte proliferation and wound healing, emphasizing its role in skin-related processes.REG-3 alpha/REG3A Protein, Mouse (HEK293, His) is the recombinant mouse-derived REG-3 alpha/REG3A protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

REG-3 alpha/REG3A Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/reg3a-protein-mouse-hek293-his.html

Purity

98.0

Smiles

EDFQKEVPSPRTSCPMGYKAYRSHCYALVMTPKSWFQADLVCQKRPSGHLVSILSGGEASFVSSLVNGRVDNYQDIWIGLHDPTMGQQPNGGGWEWSNSDVLNYLNWDGDPSSTVNRGHCGSLTASSGFLKWGDYYCDGTLPFVCKFKQ

Molecular Formula

19694 (Gene_ID) NP_035389 (E27-Q175) (Accession)

Molecular Weight

Approximately 18 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCCIP sgRNA CRISPR Lentivector (Human) (Target 3)
K0174204 1.0 µg DNA

BCCIP sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Adck4 3'UTR GFP Stable Cell Line
TU250301 1.0 mL

Adck4 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
(1R,3aR,4S,7aR) -Octahydro-7a-methyl-1-[ (1R,2E,4R) -1,4,5-trimethyl-2-hexen-1-yl]-1H-inden-4-ol
018653 10 mg

(1R,3aR,4S,7aR) -Octahydro-7a-methyl-1-[ (1R,2E,4R) -1,4,5-trimethyl-2-hexen-1-yl]-1H-inden-4-ol

Sign In for Pricing
View Details
NK1R Antibody (YA7707, Rabbit)
HY-P88022 1 Each

NK1R Antibody (YA7707, Rabbit)

Sign In for Pricing
View Details
anti-TAP2
YF-PA14915 100 ug

anti-TAP2

Sign In for Pricing
View Details
Lentiviral human SPRY1 shRNA (UAS) - Lentiviral human SPRY1 shRNA (UAS, RFP) (100)
GTR15341271 1 Vial

Lentiviral human SPRY1 shRNA (UAS) - Lentiviral human SPRY1 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details