Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Oncomodulin (Ocm)

Product Specifications

Product Name Alternative

Parvalbumin beta

Abbreviation

Recombinant Rat Ocm protein

Gene Name

Ocm

UniProt

P02631

Expression Region

2-109aa

Organism

Rattus norvegicus (Rat)

Target Sequence

SITDILSAEDIAAALQECQDPDTFEPQKFFQTSGLSKMSASQVKDIFRFIDNDQSGYLDGDELKYFLQKFQSDARELTESETKSLMDAADNDGDGKIGADEFQEMVHS

Tag

N-terminal 10xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Relevance

Has some calmodulin-like activity with respect to enzyme activation and growth regulation. Binds two calcium ions.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

14.5 kDa

References & Citations

"Solution structure of Ca2+-free rat beta-parvalbumin (oncomodulin) ." Henzl M.T., Tanner J.J. Protein Sci. 16:1914-1926 (2007)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Clathrin Heavy Chain Antibody [N1G10]
F4602-20uL 20 µL

Clathrin Heavy Chain Antibody [N1G10]

Sign In for Pricing
View Details
Human Olfactomedin 4 (OLFM4) ELISA Kit
abx152588-01 96 Tests

Human Olfactomedin 4 (OLFM4) ELISA Kit

Sign In for Pricing
View Details
Human Olfactomedin 4 (OLFM4) ELISA Kit
abx152588-02 5x 96 Tests

Human Olfactomedin 4 (OLFM4) ELISA Kit

Sign In for Pricing
View Details
Human Olfactomedin 4 (OLFM4) ELISA Kit
abx152588-03 10x 96 Tests

Human Olfactomedin 4 (OLFM4) ELISA Kit

Sign In for Pricing
View Details
Polyclonal Antibody to Activin A (ACVA)
MBS2025980-01 0.1 mL

Polyclonal Antibody to Activin A (ACVA)

Sign In for Pricing
View Details
Polyclonal Antibody to Activin A (ACVA)
MBS2025980-02 0.2 mL

Polyclonal Antibody to Activin A (ACVA)

Sign In for Pricing
View Details