Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human N-myc-interactor (NMI), partial

Product Specifications

Product Name Alternative

(Nmi) (N-myc and STAT interactor)

Abbreviation

Recombinant Human NMI protein, partial

Gene Name

NMI

UniProt

Q13287

Expression Region

62-202aa

Organism

Homo sapiens (Human)

Target Sequence

EDIPETKMKFLSVETPENDSQLSNISCSFQVSSKVPYEIQKGQALITFEKEEVAQNVVSMSKHHVQIKDVNLEVTAKPVPLNSGVRFQVYVEVSKMKINVTEIPDTLREDQMRDKLELSFSKSRNGGGEVDRVDYDRQSGS

Tag

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Acts as a signaling pathway regulator involved in innate immune system response. In response to interleukin 2/IL2 and interferon IFN-gamma/IFNG, interacts with signal transducer and activator of transcription/STAT which activate the transcription of downstream genes involved in a multitude of signals for development and homeostasis. Enhances the recruitment of CBP/p300 coactivators to STAT1 and STAT5, resulting in increased STAT1- and STAT5-dependent transcription. In response to interferon IFN-alpha, associates in a complex with signaling pathway regulator IFI35 to regulate immune response; the complex formation prevents proteasome-mediated degradation of IFI35. In complex with IFI35, inhibits virus-triggered type I IFN-beta production when ubiquitinated by ubiquitin-protein ligase TRIM21. In complex with IFI35, negatively regulates nuclear factor NF-kappa-B signaling by inhibiting the nuclear translocation, activation and transcription of NF-kappa-B subunit p65/RELA, resulting in the inhibition of endothelial cell proliferation, migration and re-endothelialization of injured arteries. Negatively regulates virus-triggered type I interferon/IFN production by inducing proteosome-dependent degradation of IRF7, a transcriptional regulator of type I IFN, thereby interfering with cellular antiviral responses. Beside its role as an intracellular signaling pathway regulator, also functions extracellularly as damage-associated molecular patterns (DAMPs) to promote inflammation, when actively released by macrophage to the extracellular space during cell injury or pathogen invasion. Macrophage-secreted NMI activates NF-kappa-B signaling in adjacent macrophages through Toll-like receptor 4/TLR4 binding and activation, thereby inducing NF-kappa-B translocation from the cytoplasm into the nucleus which promotes the release of pro-inflammatory cytokines.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

51.1 kDa

References & Citations

"Interferon-induced protein 35 inhibits endothelial cell proliferation, migration and re-endothelialization of injured arteries by inhibiting the nuclear factor-kappa B pathway." Jian D., Wang W., Zhou X., Jia Z., Wang J., Yang M., Zhao W., Jiang Z., Hu X., Zhu J. Acta Physiol. 223:e13037-e13037 (2018)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12932912/

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human Ragulator complex protein LAMTOR5 ELISA Kit
MBS9427008-01 96 Tests

Human Ragulator complex protein LAMTOR5 ELISA Kit

Ask
View Details
Human Ragulator complex protein LAMTOR5 ELISA Kit
MBS9427008-02 5x 96 Tests

Human Ragulator complex protein LAMTOR5 ELISA Kit

Ask
View Details
PPP1R3G (NM_001145115) Human Recombinant Protein
PH33329M5 20 µg

PPP1R3G (NM_001145115) Human Recombinant Protein

Ask
View Details
Rabbit Monoclonal Hepcidin Antimicrobial Peptide Antibody (4C5)
NBP3-26242-100ul 100 µL

Rabbit Monoclonal Hepcidin Antimicrobial Peptide Antibody (4C5)

Ask
View Details
USP15, NT (USP15, KIAA0529, Ubiquitin carboxyl-terminal hydrolase 15, Deubiquitinating enzyme 15, Ubiquitin thioesterase 15, Ubiquitin-specific-processing protease 15, Unph-2, Unph4)
MBS6001724-01 0.2 mL

USP15, NT (USP15, KIAA0529, Ubiquitin carboxyl-terminal hydrolase 15, Deubiquitinating enzyme 15, Ubiquitin thioesterase 15, Ubiquitin-specific-processing protease 15, Unph-2, Unph4)

Ask
View Details
USP15, NT (USP15, KIAA0529, Ubiquitin carboxyl-terminal hydrolase 15, Deubiquitinating enzyme 15, Ubiquitin thioesterase 15, Ubiquitin-specific-processing protease 15, Unph-2, Unph4)
MBS6001724-02 5x 0.2 mL

USP15, NT (USP15, KIAA0529, Ubiquitin carboxyl-terminal hydrolase 15, Deubiquitinating enzyme 15, Ubiquitin thioesterase 15, Ubiquitin-specific-processing protease 15, Unph-2, Unph4)

Ask
View Details