Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus elongatus Circadian clock oscillator protein KaiB (kaiB)

Product Specifications

Abbreviation

Recombinant Synechococcus elongatus kaiB protein

Gene Name

KaiB

UniProt

Q79PF5

Expression Region

1-102aa

Organism

Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805) (Anacystis nidulans R2)

Target Sequence

MSPRKTYILKLYVAGNTPNSVRALKTLKNILEVEFQGVYALKVIDVLKNPQLAEEDKILATPTLAKVLPLPVRRIIGDLSDREKVLIGLDLLYGELQDSDDF

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Component of the KaiABC clock protein complex, which constitutes the main circadian regulator in cyanobacteria. The KaiABC complex may act as a promoter-non-specific transcription regulator that represses transcription, possibly by acting on the state of chromosome compaction. In the complex, it decreases the phosphorylation status of KaiC. It has no effect on KaiC by itself, but instead need the presence of both KaiA and KaiC, suggesting that it acts by antagonizing the interaction between KaiA and KaiC.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CWF19-Like Protein 2 (CWF19L2) ELISA Kit
abx386746 96 Tests

Human CWF19-Like Protein 2 (CWF19L2) ELISA Kit

Sign In for Pricing
View Details
Mmu-miR-3077-3p mimic
HY-R02942-01 5 nmol

Mmu-miR-3077-3p mimic

Sign In for Pricing
View Details
Mmu-miR-3077-3p mimic
HY-R02942-02 20 nmol

Mmu-miR-3077-3p mimic

Sign In for Pricing
View Details
Goat Polyclonal Goat anti-Mouse IgM Secondary Antibody [Allophycocyanin/Cy7]
NBP1-75189APCCY7 0.5 mL

Goat Polyclonal Goat anti-Mouse IgM Secondary Antibody [Allophycocyanin/Cy7]

Sign In for Pricing
View Details
TBX3 Blocking Peptide
MBS9624941-01 1 mg

TBX3 Blocking Peptide

Sign In for Pricing
View Details
TBX3 Blocking Peptide
MBS9624941-02 5x 1 mg

TBX3 Blocking Peptide

Sign In for Pricing
View Details