Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein H/APOH, Human (HEK293, His)

Apolipoprotein H Protein, Human (HEK293, His) expresses in HEK293 with a His tag at the C-terminus. Apolipoprotein H (ApoH) is the main target of anti-phospholipid antibodies (aPLs) found in many patients with systemic lupus erythematosus and antiphospholipid syndrome (APS) [1].

Product Specifications

Product Name Alternative

Apolipoprotein H/APOH Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apolipoprotein-h-protein-human-hek293-his.html

Purity

97.00

Smiles

GRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC

Molecular Formula

350 (Gene_ID) P02749 (G20-C345) (Accession)

Molecular Weight

Approximately 45-70 kDa

References & Citations

[1]Mather KA, et al. Genome-wide significant results identified for plasma apolipoprotein H levels in middle-agedand older adults. Sci Rep. 2016 Mar 31;6:23675.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PROTAC 20S proteasome subunit β5 degrader 1
HY-169134 1 Each

PROTAC 20S proteasome subunit β5 degrader 1

Sign In for Pricing
View Details
Olfr460 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4188305 3x 1.0 µg

Olfr460 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) MYB97 Polyclonal Antibody
MBS7190183 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) MYB97 Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human IRF1 sgRNA gene knockout kit - Lentiviral human IRF1 sgRNA gene knockout kit (plasmid)
GTR15388460 1 Vial

Lentiviral human IRF1 sgRNA gene knockout kit - Lentiviral human IRF1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
BDNF Human, His
PT-A00466-01 5 µg

BDNF Human, His

Sign In for Pricing
View Details
BDNF Human, His
PT-A00466-02 20 µg

BDNF Human, His

Sign In for Pricing
View Details