Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein H/APOH, Human (HEK293, His)

Apolipoprotein H Protein, Human (HEK293, His) expresses in HEK293 with a His tag at the C-terminus. Apolipoprotein H (ApoH) is the main target of anti-phospholipid antibodies (aPLs) found in many patients with systemic lupus erythematosus and antiphospholipid syndrome (APS) [1].

Product Specifications

Product Name Alternative

Apolipoprotein H/APOH Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apolipoprotein-h-protein-human-hek293-his.html

Purity

97.00

Smiles

GRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC

Molecular Formula

350 (Gene_ID) P02749 (G20-C345) (Accession)

Molecular Weight

Approximately 45-70 kDa

References & Citations

[1]Mather KA, et al. Genome-wide significant results identified for plasma apolipoprotein H levels in middle-agedand older adults. Sci Rep. 2016 Mar 31;6:23675.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHO Monoclonal CD20 Antibody (ocrelizumab) - Humanized - (Dry Ice)
NBP3-28406-1mg 1 mg

CHO Monoclonal CD20 Antibody (ocrelizumab) - Humanized - (Dry Ice)

Sign In for Pricing
View Details
EIF1AX protein (His tag)
80R-1475 100 ug

EIF1AX protein (His tag)

Sign In for Pricing
View Details
FR181157
HY-120123 1 Each

FR181157

Sign In for Pricing
View Details
CRBN ligand-364
HY-W953161 1 Each

CRBN ligand-364

Sign In for Pricing
View Details
Vmn2r16 Protein Vector (Mouse) (pPM-C-His)
PV246097 500 ng

Vmn2r16 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
UBE2Q2 CRISPR Activation Plasmid (m2)
sc-430907-ACT-2 20 µg

UBE2Q2 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details