Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein H/APOH, Human (HEK293, His)

Apolipoprotein H Protein, Human (HEK293, His) expresses in HEK293 with a His tag at the C-terminus. Apolipoprotein H (ApoH) is the main target of anti-phospholipid antibodies (aPLs) found in many patients with systemic lupus erythematosus and antiphospholipid syndrome (APS) [1].

Product Specifications

Product Name Alternative

Apolipoprotein H/APOH Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apolipoprotein-h-protein-human-hek293-his.html

Purity

97.00

Smiles

GRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC

Molecular Formula

350 (Gene_ID) P02749 (G20-C345) (Accession)

Molecular Weight

Approximately 45-70 kDa

References & Citations

[1]Mather KA, et al. Genome-wide significant results identified for plasma apolipoprotein H levels in middle-agedand older adults. Sci Rep. 2016 Mar 31;6:23675.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dystrobrevin alpha (DTNA) (NM_001128175) Human Tagged ORF Clone Lentiviral Particle
RC225568L4V 200 µL

Dystrobrevin alpha (DTNA) (NM_001128175) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
THAP11 protein (His tag)
80R-3875 50 ug

THAP11 protein (His tag)

Sign In for Pricing
View Details
TRPV2 Antibody
C42038-01 50 µL

TRPV2 Antibody

Sign In for Pricing
View Details
TRPV2 Antibody
C42038-02 100 µL

TRPV2 Antibody

Sign In for Pricing
View Details
MYL9, CT (MYL9, MLC2, MRLC1, MYRL2, Myosin regulatory light polypeptide 9, 20kD myosin light chain, MLC-2C, Myosin RLC, Myosin regulatory light chain 2, smooth muscle isoform, Myosin regulatory light chain 9, Myosin regulatory light chain MRLC1) (MaxLight
MBS6323369-01 0.1 mL

MYL9, CT (MYL9, MLC2, MRLC1, MYRL2, Myosin regulatory light polypeptide 9, 20kD myosin light chain, MLC-2C, Myosin RLC, Myosin regulatory light chain 2, smooth muscle isoform, Myosin regulatory light chain 9, Myosin regulatory light chain MRLC1) (MaxLight

Sign In for Pricing
View Details
MYL9, CT (MYL9, MLC2, MRLC1, MYRL2, Myosin regulatory light polypeptide 9, 20kD myosin light chain, MLC-2C, Myosin RLC, Myosin regulatory light chain 2, smooth muscle isoform, Myosin regulatory light chain 9, Myosin regulatory light chain MRLC1) (MaxLight
MBS6323369-02 5x 0.1 mL

MYL9, CT (MYL9, MLC2, MRLC1, MYRL2, Myosin regulatory light polypeptide 9, 20kD myosin light chain, MLC-2C, Myosin RLC, Myosin regulatory light chain 2, smooth muscle isoform, Myosin regulatory light chain 9, Myosin regulatory light chain MRLC1) (MaxLight

Sign In for Pricing
View Details