Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein H/APOH, Human (HEK293, His)

Apolipoprotein H Protein, Human (HEK293, His) expresses in HEK293 with a His tag at the C-terminus. Apolipoprotein H (ApoH) is the main target of anti-phospholipid antibodies (aPLs) found in many patients with systemic lupus erythematosus and antiphospholipid syndrome (APS) [1].

Product Specifications

Product Name Alternative

Apolipoprotein H/APOH Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apolipoprotein-h-protein-human-hek293-his.html

Purity

97.00

Smiles

GRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC

Molecular Formula

350 (Gene_ID) P02749 (G20-C345) (Accession)

Molecular Weight

Approximately 45-70 kDa

References & Citations

[1]Mather KA, et al. Genome-wide significant results identified for plasma apolipoprotein H levels in middle-agedand older adults. Sci Rep. 2016 Mar 31;6:23675.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM164 sgRNA CRISPR Lentivector (Human) (Target 3)
K2401804 1.0 µg DNA

TMEM164 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Human BAALC shRNA Plasmid
abx962627-01 150 µg

Human BAALC shRNA Plasmid

Sign In for Pricing
View Details
Human BAALC shRNA Plasmid
abx962627-02 300 µg

Human BAALC shRNA Plasmid

Sign In for Pricing
View Details
Rat Matrix Metalloproteinase 8 (MMP8) siRNA
abx924328-01 15 nmol

Rat Matrix Metalloproteinase 8 (MMP8) siRNA

Sign In for Pricing
View Details
Rat Matrix Metalloproteinase 8 (MMP8) siRNA
abx924328-02 30 nmol

Rat Matrix Metalloproteinase 8 (MMP8) siRNA

Sign In for Pricing
View Details
CYP4F59P Protein Vector (Human) (pPM-C-His)
PV072084 500 ng

CYP4F59P Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details