Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein H/APOH, Human (HEK293, His)

Apolipoprotein H Protein, Human (HEK293, His) expresses in HEK293 with a His tag at the C-terminus. Apolipoprotein H (ApoH) is the main target of anti-phospholipid antibodies (aPLs) found in many patients with systemic lupus erythematosus and antiphospholipid syndrome (APS) [1].

Product Specifications

Product Name Alternative

Apolipoprotein H/APOH Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apolipoprotein-h-protein-human-hek293-his.html

Purity

97.00

Smiles

GRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC

Molecular Formula

350 (Gene_ID) P02749 (G20-C345) (Accession)

Molecular Weight

Approximately 45-70 kDa

References & Citations

[1]Mather KA, et al. Genome-wide significant results identified for plasma apolipoprotein H levels in middle-agedand older adults. Sci Rep. 2016 Mar 31;6:23675.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-IL-15 Antibody (DISC0280)
F1253-50 50 mg

Anti-IL-15 Antibody (DISC0280)

Sign In for Pricing
View Details
XDH Rabbit Polyclonal Antibody
R1119PS 1 mg

XDH Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
C16orf10 sgRNA CRISPR Lentivector (Human) (Target 2)
K0310303 1.0 µg DNA

C16orf10 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Rabbit anti-Human immunodeficiency virus type 1 group M subtype B (isolate ARV2/SF2)(HIV-1) ENV Polyclonal Antibody
MBS7164272 Inquire

Rabbit anti-Human immunodeficiency virus type 1 group M subtype B (isolate ARV2/SF2)(HIV-1) ENV Polyclonal Antibody

Sign In for Pricing
View Details
HOXA9 Human siRNA Oligo Duplex (Locus ID 3205)
SR302185 1 Kit

HOXA9 Human siRNA Oligo Duplex (Locus ID 3205)

Sign In for Pricing
View Details
POM121L6P 3'UTR Luciferase Stable Cell Line
TU018455 1.0 mL

POM121L6P 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details