Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein H/APOH, Human (HEK293, His)

Apolipoprotein H Protein, Human (HEK293, His) expresses in HEK293 with a His tag at the C-terminus. Apolipoprotein H (ApoH) is the main target of anti-phospholipid antibodies (aPLs) found in many patients with systemic lupus erythematosus and antiphospholipid syndrome (APS) [1].

Product Specifications

Product Name Alternative

Apolipoprotein H/APOH Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apolipoprotein-h-protein-human-hek293-his.html

Purity

97.00

Smiles

GRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC

Molecular Formula

350 (Gene_ID) P02749 (G20-C345) (Accession)

Molecular Weight

Approximately 45-70 kDa

References & Citations

[1]Mather KA, et al. Genome-wide significant results identified for plasma apolipoprotein H levels in middle-agedand older adults. Sci Rep. 2016 Mar 31;6:23675.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Easypro Rat Glucokinase (GCK) ELISA Kit
FY-ER2057S 96 Well

Easypro Rat Glucokinase (GCK) ELISA Kit

Sign In for Pricing
View Details
RPS2P47 sgRNA CRISPR Lentivector set (Human)
K2003701 3x 1.0 µg

RPS2P47 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Kv1.2 (Kcna2, Voltage-gated Potassium Channel) (AP)
MBS6241973-01 0.1 mL

Kv1.2 (Kcna2, Voltage-gated Potassium Channel) (AP)

Sign In for Pricing
View Details
Kv1.2 (Kcna2, Voltage-gated Potassium Channel) (AP)
MBS6241973-02 5x 0.1 mL

Kv1.2 (Kcna2, Voltage-gated Potassium Channel) (AP)

Sign In for Pricing
View Details
TRAAK Lentiviral Activation Particles (h)
sc-407790-LAC 200 µL

TRAAK Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
SLC28A2 Protein Lysate (Mouse) with C-HA Tag
44082034 100 µg

SLC28A2 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details