Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein H/APOH, Human (HEK293, His)

Apolipoprotein H Protein, Human (HEK293, His) expresses in HEK293 with a His tag at the C-terminus. Apolipoprotein H (ApoH) is the main target of anti-phospholipid antibodies (aPLs) found in many patients with systemic lupus erythematosus and antiphospholipid syndrome (APS) [1].

Product Specifications

Product Name Alternative

Apolipoprotein H/APOH Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apolipoprotein-h-protein-human-hek293-his.html

Purity

97.00

Smiles

GRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC

Molecular Formula

350 (Gene_ID) P02749 (G20-C345) (Accession)

Molecular Weight

Approximately 45-70 kDa

References & Citations

[1]Mather KA, et al. Genome-wide significant results identified for plasma apolipoprotein H levels in middle-agedand older adults. Sci Rep. 2016 Mar 31;6:23675.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTRF1 (NM_004294) Human Tagged ORF Clone
RC207912 10 µg

MTRF1 (NM_004294) Human Tagged ORF Clone

Sign In for Pricing
View Details
Snapc3 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3660402 1.0 µg DNA

Snapc3 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Rat CREB-regulated transcription coactivator 1 (CRTC1) ELISA Kit
MBS7206847-01 48 Well

Rat CREB-regulated transcription coactivator 1 (CRTC1) ELISA Kit

Sign In for Pricing
View Details
Rat CREB-regulated transcription coactivator 1 (CRTC1) ELISA Kit
MBS7206847-02 96 Well

Rat CREB-regulated transcription coactivator 1 (CRTC1) ELISA Kit

Sign In for Pricing
View Details
Rat CREB-regulated transcription coactivator 1 (CRTC1) ELISA Kit
MBS7206847-03 5x 96 Well

Rat CREB-regulated transcription coactivator 1 (CRTC1) ELISA Kit

Sign In for Pricing
View Details
Rat CREB-regulated transcription coactivator 1 (CRTC1) ELISA Kit
MBS7206847-04 10x 96 Well

Rat CREB-regulated transcription coactivator 1 (CRTC1) ELISA Kit

Sign In for Pricing
View Details