Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein H/APOH, Human (HEK293, His)

Apolipoprotein H Protein, Human (HEK293, His) expresses in HEK293 with a His tag at the C-terminus. Apolipoprotein H (ApoH) is the main target of anti-phospholipid antibodies (aPLs) found in many patients with systemic lupus erythematosus and antiphospholipid syndrome (APS) [1].

Product Specifications

Product Name Alternative

Apolipoprotein H/APOH Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apolipoprotein-h-protein-human-hek293-his.html

Purity

97.00

Smiles

GRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC

Molecular Formula

350 (Gene_ID) P02749 (G20-C345) (Accession)

Molecular Weight

Approximately 45-70 kDa

References & Citations

[1]Mather KA, et al. Genome-wide significant results identified for plasma apolipoprotein H levels in middle-agedand older adults. Sci Rep. 2016 Mar 31;6:23675.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CMAS Knockout HEK293T cell line
GTR15421435 1 Vial

Human CMAS Knockout HEK293T cell line

Sign In for Pricing
View Details
Kdm2a sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6424706 1.0 µg DNA

Kdm2a sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Pan2 Mouse shRNA Lentiviral Particle (Locus ID 103135)
TL514879V 500 µL Each

Pan2 Mouse shRNA Lentiviral Particle (Locus ID 103135)

Sign In for Pricing
View Details
OAS2 Mouse Monoclonal Antibody [Clone ID: OTI5C3]
CF802805 100 µg

OAS2 Mouse Monoclonal Antibody [Clone ID: OTI5C3]

Sign In for Pricing
View Details
Human GPR171 knockout cell line
ABC-KH6341 1 Vial

Human GPR171 knockout cell line

Sign In for Pricing
View Details
MSL3L1 (MSL3) (NM_078629) Human Over-expression Lysate
LH13417V 100 µg

MSL3L1 (MSL3) (NM_078629) Human Over-expression Lysate

Sign In for Pricing
View Details