Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein H/APOH, Human (HEK293, His)

Apolipoprotein H Protein, Human (HEK293, His) expresses in HEK293 with a His tag at the C-terminus. Apolipoprotein H (ApoH) is the main target of anti-phospholipid antibodies (aPLs) found in many patients with systemic lupus erythematosus and antiphospholipid syndrome (APS) [1].

Product Specifications

Product Name Alternative

Apolipoprotein H/APOH Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apolipoprotein-h-protein-human-hek293-his.html

Purity

97.00

Smiles

GRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC

Molecular Formula

350 (Gene_ID) P02749 (G20-C345) (Accession)

Molecular Weight

Approximately 45-70 kDa

References & Citations

[1]Mather KA, et al. Genome-wide significant results identified for plasma apolipoprotein H levels in middle-agedand older adults. Sci Rep. 2016 Mar 31;6:23675.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

AHI1 Rabbit Polyclonal Antibody
TA308513 100 µL

AHI1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DCAF8L2 (NM_001136533) Human Tagged ORF Clone Lentiviral Particle
RC227267L3V 200 µL

DCAF8L2 (NM_001136533) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
DBC-2 (G-12)
sc-398774 200 µg/mL

DBC-2 (G-12)

Sign In for Pricing
View Details
KDELC2 Antibody - C-terminal region
MBS3218556-01 0.1 mL

KDELC2 Antibody - C-terminal region

Sign In for Pricing
View Details
KDELC2 Antibody - C-terminal region
MBS3218556-02 5x 0.1 mL

KDELC2 Antibody - C-terminal region

Sign In for Pricing
View Details
OR7E66P Protein Vector (Human) (pPM-C-His)
PV108717 500 ng

OR7E66P Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details