Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein H/APOH, Human (HEK293, His)

Apolipoprotein H Protein, Human (HEK293, His) expresses in HEK293 with a His tag at the C-terminus. Apolipoprotein H (ApoH) is the main target of anti-phospholipid antibodies (aPLs) found in many patients with systemic lupus erythematosus and antiphospholipid syndrome (APS) [1].

Product Specifications

Product Name Alternative

Apolipoprotein H/APOH Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apolipoprotein-h-protein-human-hek293-his.html

Purity

97.00

Smiles

GRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC

Molecular Formula

350 (Gene_ID) P02749 (G20-C345) (Accession)

Molecular Weight

Approximately 45-70 kDa

References & Citations

[1]Mather KA, et al. Genome-wide significant results identified for plasma apolipoprotein H levels in middle-agedand older adults. Sci Rep. 2016 Mar 31;6:23675.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMP26 (Matrix Metalloproteinase-26, MMP-26, Matrilysin-2, Endometase, MGC126590, MGC126592)
MBS644164-01 0.1 mg

MMP26 (Matrix Metalloproteinase-26, MMP-26, Matrilysin-2, Endometase, MGC126590, MGC126592)

Sign In for Pricing
View Details
MMP26 (Matrix Metalloproteinase-26, MMP-26, Matrilysin-2, Endometase, MGC126590, MGC126592)
MBS644164-02 5x 0.1 mg

MMP26 (Matrix Metalloproteinase-26, MMP-26, Matrilysin-2, Endometase, MGC126590, MGC126592)

Sign In for Pricing
View Details
ZN735 rabbit pAb
UB-GEN-8160 100 µL

ZN735 rabbit pAb

Sign In for Pricing
View Details
pLV3-CMV-SOD1-EF1a-CopGFP-Puro Plasmid
PVT54139 2 µg

pLV3-CMV-SOD1-EF1a-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
Lentiviral mouse Tas1r1 shRNA (UAS) - Lentiviral mouse Tas1r1 shRNA (UAS, GFP) (100)
GTR15241221 1 Vial

Lentiviral mouse Tas1r1 shRNA (UAS) - Lentiviral mouse Tas1r1 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Human Phosphatidylinositol 3-Kinase Catalytic Subunit Type 3 or Vps34, PIK3C3 ELISA Kit
MBS1608858-01 48 Well

Human Phosphatidylinositol 3-Kinase Catalytic Subunit Type 3 or Vps34, PIK3C3 ELISA Kit

Sign In for Pricing
View Details