Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein H/APOH, Human (HEK293, His)

Apolipoprotein H Protein, Human (HEK293, His) expresses in HEK293 with a His tag at the C-terminus. Apolipoprotein H (ApoH) is the main target of anti-phospholipid antibodies (aPLs) found in many patients with systemic lupus erythematosus and antiphospholipid syndrome (APS) [1].

Product Specifications

Product Name Alternative

Apolipoprotein H/APOH Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apolipoprotein-h-protein-human-hek293-his.html

Purity

97.00

Smiles

GRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC

Molecular Formula

350 (Gene_ID) P02749 (G20-C345) (Accession)

Molecular Weight

Approximately 45-70 kDa

References & Citations

[1]Mather KA, et al. Genome-wide significant results identified for plasma apolipoprotein H levels in middle-agedand older adults. Sci Rep. 2016 Mar 31;6:23675.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL8 Protein Vector (Rat) (pPB-N-His)
PV302307 500 ng

RPL8 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
IKK beta (C3) Peptide
MBS151901-01 0.05 mg

IKK beta (C3) Peptide

Sign In for Pricing
View Details
IKK beta (C3) Peptide
MBS151901-02 5x 0.05 mg

IKK beta (C3) Peptide

Sign In for Pricing
View Details
OAT-3 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-42422R-BF680 100 µL

OAT-3 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Rabbit Monoclonal Transgelin/TAGLN/SM22 alpha Antibody (SAIC-33B-129) [DyLight 594]
NBP3-20101DL594 0.1 mL

Rabbit Monoclonal Transgelin/TAGLN/SM22 alpha Antibody (SAIC-33B-129) [DyLight 594]

Sign In for Pricing
View Details
NEK7 Polyclonal Antibody, Cy5.5 Conjugated
bs-7758R-Cy5.5 100 µL

NEK7 Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details