Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein H/APOH, Human (HEK293, His)

Apolipoprotein H Protein, Human (HEK293, His) expresses in HEK293 with a His tag at the C-terminus. Apolipoprotein H (ApoH) is the main target of anti-phospholipid antibodies (aPLs) found in many patients with systemic lupus erythematosus and antiphospholipid syndrome (APS) [1].

Product Specifications

Product Name Alternative

Apolipoprotein H/APOH Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apolipoprotein-h-protein-human-hek293-his.html

Purity

97.00

Smiles

GRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC

Molecular Formula

350 (Gene_ID) P02749 (G20-C345) (Accession)

Molecular Weight

Approximately 45-70 kDa

References & Citations

[1]Mather KA, et al. Genome-wide significant results identified for plasma apolipoprotein H levels in middle-agedand older adults. Sci Rep. 2016 Mar 31;6:23675.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPA-70 (replication protein A) Porcine ELISA Kit
G8485 96 Tests

RPA-70 (replication protein A) Porcine ELISA Kit

Sign In for Pricing
View Details
EIF2AK4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV709635 1.0 µg DNA

EIF2AK4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
ISRE-TAL-BSD
LTV-0021-4S 2x10^6

ISRE-TAL-BSD

Sign In for Pricing
View Details
FAM213A Recombinant Protein Antigen
NBP2-48573PEP 0.1 mL

FAM213A Recombinant Protein Antigen

Sign In for Pricing
View Details
Rpap1 (NM_001163701) Mouse Tagged Lenti ORF Clone
MR218285L4 10 µg

Rpap1 (NM_001163701) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mouse Monoclonal ETV7 Antibody (OTI3B2) [Alexa Fluor 488]
NBP2-71938AF488 0.1 mL

Mouse Monoclonal ETV7 Antibody (OTI3B2) [Alexa Fluor 488]

Sign In for Pricing
View Details