Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein H/APOH, Human (HEK293, His)

Apolipoprotein H Protein, Human (HEK293, His) expresses in HEK293 with a His tag at the C-terminus. Apolipoprotein H (ApoH) is the main target of anti-phospholipid antibodies (aPLs) found in many patients with systemic lupus erythematosus and antiphospholipid syndrome (APS) [1].

Product Specifications

Product Name Alternative

Apolipoprotein H/APOH Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apolipoprotein-h-protein-human-hek293-his.html

Purity

97.00

Smiles

GRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC

Molecular Formula

350 (Gene_ID) P02749 (G20-C345) (Accession)

Molecular Weight

Approximately 45-70 kDa

References & Citations

[1]Mather KA, et al. Genome-wide significant results identified for plasma apolipoprotein H levels in middle-agedand older adults. Sci Rep. 2016 Mar 31;6:23675.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C16orf47 Protein Vector (Human) (pPB-His-GST)
PV329103 500 ng

C16orf47 Protein Vector (Human) (pPB-His-GST)

Sign In for Pricing
View Details
Phospho-PRKCQ (Ser695) Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-5584R-BF594 100 µL

Phospho-PRKCQ (Ser695) Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Anti-[KO Validated] HP1 alpha/CBX5 (Rabbit, Polyclonal)
A106775 100 µL

Anti-[KO Validated] HP1 alpha/CBX5 (Rabbit, Polyclonal)

Sign In for Pricing
View Details
AP4M1 Knockout huh-7 Polyclonal Cells
ARG27926 1 Million

AP4M1 Knockout huh-7 Polyclonal Cells

Sign In for Pricing
View Details
5,6-Diaminoindazole
MBS6073208-01 500 mg

5,6-Diaminoindazole

Sign In for Pricing
View Details
5,6-Diaminoindazole
MBS6073208-02 5x 500 mg

5,6-Diaminoindazole

Sign In for Pricing
View Details