Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein H/APOH, Human (HEK293, His)

Apolipoprotein H Protein, Human (HEK293, His) expresses in HEK293 with a His tag at the C-terminus. Apolipoprotein H (ApoH) is the main target of anti-phospholipid antibodies (aPLs) found in many patients with systemic lupus erythematosus and antiphospholipid syndrome (APS) [1].

Product Specifications

Product Name Alternative

Apolipoprotein H/APOH Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apolipoprotein-h-protein-human-hek293-his.html

Purity

97.00

Smiles

GRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC

Molecular Formula

350 (Gene_ID) P02749 (G20-C345) (Accession)

Molecular Weight

Approximately 45-70 kDa

References & Citations

[1]Mather KA, et al. Genome-wide significant results identified for plasma apolipoprotein H levels in middle-agedand older adults. Sci Rep. 2016 Mar 31;6:23675.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSC22D1 CRISPRa sgRNA lentivector (set of three targets)(Rat)
48545126 3x 1.0µg DNA

TSC22D1 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Ptafr Rat Pre-designed siRNA Set A
HY-RS11349 1 Set

Ptafr Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
GJB6 (NM_001110221) Human Tagged ORF Clone Lentiviral Particle
RC225344L3V 200 µL

GJB6 (NM_001110221) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Tlr2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
46776114 3x 1.0 µg

Tlr2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Rabbit Polyclonal Rabbit anti-Sheep IgM (H+L) Secondary Antibody [Janelia Fluor 549]
NBP2-68363JF549 1 mL

Rabbit Polyclonal Rabbit anti-Sheep IgM (H+L) Secondary Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
SEC63 Protein Vector (Mouse) (pPB-N-His)
PV227483 500 ng

SEC63 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details