Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein H/APOH, Human (HEK293, His)

Apolipoprotein H Protein, Human (HEK293, His) expresses in HEK293 with a His tag at the C-terminus. Apolipoprotein H (ApoH) is the main target of anti-phospholipid antibodies (aPLs) found in many patients with systemic lupus erythematosus and antiphospholipid syndrome (APS) [1].

Product Specifications

Product Name Alternative

Apolipoprotein H/APOH Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apolipoprotein-h-protein-human-hek293-his.html

Purity

97.00

Smiles

GRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC

Molecular Formula

350 (Gene_ID) P02749 (G20-C345) (Accession)

Molecular Weight

Approximately 45-70 kDa

References & Citations

[1]Mather KA, et al. Genome-wide significant results identified for plasma apolipoprotein H levels in middle-agedand older adults. Sci Rep. 2016 Mar 31;6:23675.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rhoc sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7538805 3x 1.0 µg

Rhoc sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Daratumumab ELISA Kit
E55K0521 96 Tests

Daratumumab ELISA Kit

Sign In for Pricing
View Details
SYNE1 (spectrin Repeat Containing, Nuclear envelope 1, 8B, CPG2, DKFZp781J13156, FLJ30878, FLJ41140, KIAA0796, KIAA1262, KIAA1756, MYNE1, SCAR8) (AP) discontinued
252314-AP 100 µL

SYNE1 (spectrin Repeat Containing, Nuclear envelope 1, 8B, CPG2, DKFZp781J13156, FLJ30878, FLJ41140, KIAA0796, KIAA1262, KIAA1756, MYNE1, SCAR8) (AP) discontinued

Sign In for Pricing
View Details
ESRRG Peptide
MBS3225591-01 0.1 mg

ESRRG Peptide

Sign In for Pricing
View Details
ESRRG Peptide
MBS3225591-02 5x 0.1 mg

ESRRG Peptide

Sign In for Pricing
View Details
Acetyl-DL-cyclopentylglycine
235130-01 250 mg

Acetyl-DL-cyclopentylglycine

Sign In for Pricing
View Details