Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein H/APOH, Human (HEK293, His)

Apolipoprotein H Protein, Human (HEK293, His) expresses in HEK293 with a His tag at the C-terminus. Apolipoprotein H (ApoH) is the main target of anti-phospholipid antibodies (aPLs) found in many patients with systemic lupus erythematosus and antiphospholipid syndrome (APS) [1].

Product Specifications

Product Name Alternative

Apolipoprotein H/APOH Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apolipoprotein-h-protein-human-hek293-his.html

Purity

97.00

Smiles

GRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC

Molecular Formula

350 (Gene_ID) P02749 (G20-C345) (Accession)

Molecular Weight

Approximately 45-70 kDa

References & Citations

[1]Mather KA, et al. Genome-wide significant results identified for plasma apolipoprotein H levels in middle-agedand older adults. Sci Rep. 2016 Mar 31;6:23675.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

COMMD1 (NM_152516) Human Tagged Lenti ORF Clone
RC205614L4 10 µg

COMMD1 (NM_152516) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CD147
045750 100 µg

CD147

Sign In for Pricing
View Details
SULT1A1 Antibody
E30AOC260 100 µL

SULT1A1 Antibody

Sign In for Pricing
View Details
SNRPD1 Antibody (C-term) Blocking Peptide
MBS9224877-01 0.5 mg

SNRPD1 Antibody (C-term) Blocking Peptide

Sign In for Pricing
View Details
SNRPD1 Antibody (C-term) Blocking Peptide
MBS9224877-02 5x 0.5 mg

SNRPD1 Antibody (C-term) Blocking Peptide

Sign In for Pricing
View Details
ULK2 Protein Vector (Rat) (pPM-C-HA)
49162026 500 ng

ULK2 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details