Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein H/APOH, Human (HEK293, His)

Apolipoprotein H Protein, Human (HEK293, His) expresses in HEK293 with a His tag at the C-terminus. Apolipoprotein H (ApoH) is the main target of anti-phospholipid antibodies (aPLs) found in many patients with systemic lupus erythematosus and antiphospholipid syndrome (APS) [1].

Product Specifications

Product Name Alternative

Apolipoprotein H/APOH Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apolipoprotein-h-protein-human-hek293-his.html

Purity

97.00

Smiles

GRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC

Molecular Formula

350 (Gene_ID) P02749 (G20-C345) (Accession)

Molecular Weight

Approximately 45-70 kDa

References & Citations

[1]Mather KA, et al. Genome-wide significant results identified for plasma apolipoprotein H levels in middle-agedand older adults. Sci Rep. 2016 Mar 31;6:23675.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal IL-17/IL-17A Antibody
NBP3-11319-0.025mg 0.025 mg

Rabbit Polyclonal IL-17/IL-17A Antibody

Sign In for Pricing
View Details
Leptin (human) ELISA Kit
K4777-100 100 assays

Leptin (human) ELISA Kit

Sign In for Pricing
View Details
Anti-Phospho-ATF4 (Ser245) Polyclonal Antibody
MF-0083991-01 50 µL

Anti-Phospho-ATF4 (Ser245) Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Phospho-ATF4 (Ser245) Polyclonal Antibody
MF-0083991-02 100 µL

Anti-Phospho-ATF4 (Ser245) Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Phospho-ATF4 (Ser245) Polyclonal Antibody
MF-0083991-03 200 µL

Anti-Phospho-ATF4 (Ser245) Polyclonal Antibody

Sign In for Pricing
View Details
IGFBP2 (NM_000597) Human Tagged ORF Clone Lentiviral Particle
RC202573L2V 200 µL

IGFBP2 (NM_000597) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details