Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein H/APOH, Human (HEK293, His)

Apolipoprotein H Protein, Human (HEK293, His) expresses in HEK293 with a His tag at the C-terminus. Apolipoprotein H (ApoH) is the main target of anti-phospholipid antibodies (aPLs) found in many patients with systemic lupus erythematosus and antiphospholipid syndrome (APS) [1].

Product Specifications

Product Name Alternative

Apolipoprotein H/APOH Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apolipoprotein-h-protein-human-hek293-his.html

Purity

97.00

Smiles

GRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC

Molecular Formula

350 (Gene_ID) P02749 (G20-C345) (Accession)

Molecular Weight

Approximately 45-70 kDa

References & Citations

[1]Mather KA, et al. Genome-wide significant results identified for plasma apolipoprotein H levels in middle-agedand older adults. Sci Rep. 2016 Mar 31;6:23675.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

mmu-miR-543 miRNA Inhibitor
MIM02271 2x 5.0 nmol

mmu-miR-543 miRNA Inhibitor

Sign In for Pricing
View Details
(± ) -Praeruptorin A 100mg
A22384-100 100 mg

(± ) -Praeruptorin A 100mg

Sign In for Pricing
View Details
Probable G-protein coupled Receptor 25 (GPR25) Mouse ELISA Kit
G1188 96 Tests

Probable G-protein coupled Receptor 25 (GPR25) Mouse ELISA Kit

Sign In for Pricing
View Details
Rabbit Anti-Mouse Interleukin 10 Receptor Alpha (IL10Ra) Polyclonal Antibody
VD3N655 1 Each

Rabbit Anti-Mouse Interleukin 10 Receptor Alpha (IL10Ra) Polyclonal Antibody

Sign In for Pricing
View Details
DNA polymerase iota (POLI) polyclonal antibody
ABP-PAB-11630 100 ug

DNA polymerase iota (POLI) polyclonal antibody

Sign In for Pricing
View Details
CCDC65 Recombinant Protein (Human)
RP050908 100 µg

CCDC65 Recombinant Protein (Human)

Sign In for Pricing
View Details