Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein H/APOH, Human (HEK293, His)

Apolipoprotein H Protein, Human (HEK293, His) expresses in HEK293 with a His tag at the C-terminus. Apolipoprotein H (ApoH) is the main target of anti-phospholipid antibodies (aPLs) found in many patients with systemic lupus erythematosus and antiphospholipid syndrome (APS) [1].

Product Specifications

Product Name Alternative

Apolipoprotein H/APOH Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apolipoprotein-h-protein-human-hek293-his.html

Purity

97.00

Smiles

GRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC

Molecular Formula

350 (Gene_ID) P02749 (G20-C345) (Accession)

Molecular Weight

Approximately 45-70 kDa

References & Citations

[1]Mather KA, et al. Genome-wide significant results identified for plasma apolipoprotein H levels in middle-agedand older adults. Sci Rep. 2016 Mar 31;6:23675.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Loxl4 Mouse shRNA Plasmid (Locus ID 67573)
TR503944 1 Kit

Loxl4 Mouse shRNA Plasmid (Locus ID 67573)

Sign In for Pricing
View Details
Mouse Regenerating Islet Derived Protein 3 Gamma (REG3g) ELISA Kit
EKU07048 96 Tests

Mouse Regenerating Islet Derived Protein 3 Gamma (REG3g) ELISA Kit

Sign In for Pricing
View Details
pCD513B-1-Flag-NKX2.8 Plasmid
PVTB01027-4a 2 µg

pCD513B-1-Flag-NKX2.8 Plasmid

Sign In for Pricing
View Details
Human Fibroblast Growth Factor 1, Acidic (FGF1) ELISA Kit
EKN45234 96 Tests

Human Fibroblast Growth Factor 1, Acidic (FGF1) ELISA Kit

Sign In for Pricing
View Details
Klk10 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3260802 1.0 µg DNA

Klk10 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
TC2N (NM_152332) Human Tagged ORF Clone
RC206331 10 µg

TC2N (NM_152332) Human Tagged ORF Clone

Sign In for Pricing
View Details