Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hemopexin, Human (HEK293, His)

Hemopexin Protein efficiently binds and transports heme to the liver for degradation, recovering iron. After this essential process, Hemopexin seamlessly re-enters circulation. It also interacts with FLVCR1, playing a multifaceted role in heme metabolism and iron homeostasis. Hemopexin Protein, Human (HEK293, His) is the recombinant human-derived Hemopexin protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Hemopexin Protein, Human (HEK293, C-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hemopexin-protein-human-hek293-c-his.html

Purity

98.00

Smiles

TPLPPTSAHGNVAEGETKPDPDVTERCSDGWSFDATTLDDNGTMLFFKGEFVWKSHKWDRELISERWKNFPSPVDAAFRQGHNSVFLIKGDKVWVYPPEKKEKGYPKLLQDEFPGIPSPLDAAVECHRGECQAEGVLFFQGDREWFWDLATGTMKERSWPAVGNCSSALRWLGRYYCFQGNQFLRFDPVRGEVPPRYPRDVRDYFMPCPGRGHGHRNGTGHGNSTHHGPEYMRCSPHLVLSALTSDNHGATYAFSGTHYWRLDTSRDGWHSWPIAHQWPQGPSAVDAAFSWEEKLYLVQGTQVYVFLTKGGYTLVSGYPKRLEKEVGTPHGIILDSVDAAFICPGSSRLHIMAGRRLWWLDLKSGAQATWTELPWPHEKVDGALCMEKSLGPNSCSANGPGLYLIHGPNLYCYSDVEKLNAAKALPQPQNVTSLLGCTH

Molecular Formula

3263 (Gene_ID) P02790 (T24-H462) (Accession)

Molecular Weight

Approximately 60-90 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adenosine A3 Receptor (ADORA3) Antibody
abx175248-01 200 µg

Adenosine A3 Receptor (ADORA3) Antibody

Sign In for Pricing
View Details
Adenosine A3 Receptor (ADORA3) Antibody
abx175248-02 1 mg

Adenosine A3 Receptor (ADORA3) Antibody

Sign In for Pricing
View Details
LOC498152 Recombinant Protein (Rat)
RP208928 100 µg

LOC498152 Recombinant Protein (Rat)

Sign In for Pricing
View Details
TAF1B (NM_005680) Human Tagged ORF Clone
RG202142 10 µg

TAF1B (NM_005680) Human Tagged ORF Clone

Sign In for Pricing
View Details
HLA Class 2 Antigen DR (HLA DR) (FITC) discontinued
H6099-96H-FITC 100 µL

HLA Class 2 Antigen DR (HLA DR) (FITC) discontinued

Sign In for Pricing
View Details
Anti-RNase H1/RNH1 Rabbit pAb
GB115406 100 μL

Anti-RNase H1/RNH1 Rabbit pAb

Sign In for Pricing
View Details