Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hemopexin, Human (HEK293, His)

Hemopexin Protein efficiently binds and transports heme to the liver for degradation, recovering iron. After this essential process, Hemopexin seamlessly re-enters circulation. It also interacts with FLVCR1, playing a multifaceted role in heme metabolism and iron homeostasis. Hemopexin Protein, Human (HEK293, His) is the recombinant human-derived Hemopexin protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Hemopexin Protein, Human (HEK293, C-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hemopexin-protein-human-hek293-c-his.html

Purity

98.00

Smiles

TPLPPTSAHGNVAEGETKPDPDVTERCSDGWSFDATTLDDNGTMLFFKGEFVWKSHKWDRELISERWKNFPSPVDAAFRQGHNSVFLIKGDKVWVYPPEKKEKGYPKLLQDEFPGIPSPLDAAVECHRGECQAEGVLFFQGDREWFWDLATGTMKERSWPAVGNCSSALRWLGRYYCFQGNQFLRFDPVRGEVPPRYPRDVRDYFMPCPGRGHGHRNGTGHGNSTHHGPEYMRCSPHLVLSALTSDNHGATYAFSGTHYWRLDTSRDGWHSWPIAHQWPQGPSAVDAAFSWEEKLYLVQGTQVYVFLTKGGYTLVSGYPKRLEKEVGTPHGIILDSVDAAFICPGSSRLHIMAGRRLWWLDLKSGAQATWTELPWPHEKVDGALCMEKSLGPNSCSANGPGLYLIHGPNLYCYSDVEKLNAAKALPQPQNVTSLLGCTH

Molecular Formula

3263 (Gene_ID) P02790 (T24-H462) (Accession)

Molecular Weight

Approximately 60-90 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Clostridium Botulinum hfq Protein (aa 1-85) (strain ATCC 19397 / Type A)
VAng-Lsx8266-50gEcoli 50 µg (E. coli)

Recombinant Clostridium Botulinum hfq Protein (aa 1-85) (strain ATCC 19397 / Type A)

Sign In for Pricing
View Details
Anti-DNAL4 Mouse mAb
MBS476403-01 0.1 mL

Anti-DNAL4 Mouse mAb

Sign In for Pricing
View Details
Anti-DNAL4 Mouse mAb
MBS476403-02 5x 0.1 mL

Anti-DNAL4 Mouse mAb

Sign In for Pricing
View Details
Human PCT Antibody Pair Set
MBS2577628-01 1 Pair

Human PCT Antibody Pair Set

Sign In for Pricing
View Details
Human PCT Antibody Pair Set
MBS2577628-02 5x 1 Pair

Human PCT Antibody Pair Set

Sign In for Pricing
View Details
OTOG rabbit pAb
ES14357-01 50 µL

OTOG rabbit pAb

Sign In for Pricing
View Details