Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hemopexin, Human (HEK293, His)

Hemopexin Protein efficiently binds and transports heme to the liver for degradation, recovering iron. After this essential process, Hemopexin seamlessly re-enters circulation. It also interacts with FLVCR1, playing a multifaceted role in heme metabolism and iron homeostasis. Hemopexin Protein, Human (HEK293, His) is the recombinant human-derived Hemopexin protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Hemopexin Protein, Human (HEK293, C-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hemopexin-protein-human-hek293-c-his.html

Purity

98.00

Smiles

TPLPPTSAHGNVAEGETKPDPDVTERCSDGWSFDATTLDDNGTMLFFKGEFVWKSHKWDRELISERWKNFPSPVDAAFRQGHNSVFLIKGDKVWVYPPEKKEKGYPKLLQDEFPGIPSPLDAAVECHRGECQAEGVLFFQGDREWFWDLATGTMKERSWPAVGNCSSALRWLGRYYCFQGNQFLRFDPVRGEVPPRYPRDVRDYFMPCPGRGHGHRNGTGHGNSTHHGPEYMRCSPHLVLSALTSDNHGATYAFSGTHYWRLDTSRDGWHSWPIAHQWPQGPSAVDAAFSWEEKLYLVQGTQVYVFLTKGGYTLVSGYPKRLEKEVGTPHGIILDSVDAAFICPGSSRLHIMAGRRLWWLDLKSGAQATWTELPWPHEKVDGALCMEKSLGPNSCSANGPGLYLIHGPNLYCYSDVEKLNAAKALPQPQNVTSLLGCTH

Molecular Formula

3263 (Gene_ID) P02790 (T24-H462) (Accession)

Molecular Weight

Approximately 60-90 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Integrin-α FG-GAP repeat-containing protein 2 (ITFG2) Bovine ELISA Kit
E3203 96 Tests

Integrin-α FG-GAP repeat-containing protein 2 (ITFG2) Bovine ELISA Kit

Sign In for Pricing
View Details
NOB1 (NM_014062) Human Tagged ORF Clone Lentiviral Particle
RC209537L1V 200 µL

NOB1 (NM_014062) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Phospho-RB-S608 polyclonal antibody
BS79404-01 50 µL

Phospho-RB-S608 polyclonal antibody

Sign In for Pricing
View Details
Phospho-RB-S608 polyclonal antibody
BS79404-02 100 µL

Phospho-RB-S608 polyclonal antibody

Sign In for Pricing
View Details
NPD014 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-6441R-BF350-01 20 µL

NPD014 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
NPD014 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-6441R-BF350-02 100 µL

NPD014 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details