Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hemopexin, Human (HEK293, His)

Hemopexin Protein efficiently binds and transports heme to the liver for degradation, recovering iron. After this essential process, Hemopexin seamlessly re-enters circulation. It also interacts with FLVCR1, playing a multifaceted role in heme metabolism and iron homeostasis. Hemopexin Protein, Human (HEK293, His) is the recombinant human-derived Hemopexin protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Hemopexin Protein, Human (HEK293, C-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hemopexin-protein-human-hek293-c-his.html

Purity

98.00

Smiles

TPLPPTSAHGNVAEGETKPDPDVTERCSDGWSFDATTLDDNGTMLFFKGEFVWKSHKWDRELISERWKNFPSPVDAAFRQGHNSVFLIKGDKVWVYPPEKKEKGYPKLLQDEFPGIPSPLDAAVECHRGECQAEGVLFFQGDREWFWDLATGTMKERSWPAVGNCSSALRWLGRYYCFQGNQFLRFDPVRGEVPPRYPRDVRDYFMPCPGRGHGHRNGTGHGNSTHHGPEYMRCSPHLVLSALTSDNHGATYAFSGTHYWRLDTSRDGWHSWPIAHQWPQGPSAVDAAFSWEEKLYLVQGTQVYVFLTKGGYTLVSGYPKRLEKEVGTPHGIILDSVDAAFICPGSSRLHIMAGRRLWWLDLKSGAQATWTELPWPHEKVDGALCMEKSLGPNSCSANGPGLYLIHGPNLYCYSDVEKLNAAKALPQPQNVTSLLGCTH

Molecular Formula

3263 (Gene_ID) P02790 (T24-H462) (Accession)

Molecular Weight

Approximately 60-90 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GS-9620 5mg
A13251-5 5 mg

GS-9620 5mg

Sign In for Pricing
View Details
ATG2A sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0141605 3x 1.0 µg

ATG2A sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
PWWP2B Antibody
A20826-100UG 100 µg

PWWP2B Antibody

Sign In for Pricing
View Details
Human Mitochondrial uncoupling protein 3, UCP3 ELISA KIT
ELI-06637h 96 Tests

Human Mitochondrial uncoupling protein 3, UCP3 ELISA KIT

Sign In for Pricing
View Details
Bovine Latrophilin 3 ELISA Kit
OM623113 96 Strip Well

Bovine Latrophilin 3 ELISA Kit

Sign In for Pricing
View Details
Anti-Phospho-JNK (T183/Y185) Mouse mAb
GB12018-100 100 μL

Anti-Phospho-JNK (T183/Y185) Mouse mAb

Sign In for Pricing
View Details