Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hemopexin, Human (HEK293, His)

Hemopexin Protein efficiently binds and transports heme to the liver for degradation, recovering iron. After this essential process, Hemopexin seamlessly re-enters circulation. It also interacts with FLVCR1, playing a multifaceted role in heme metabolism and iron homeostasis. Hemopexin Protein, Human (HEK293, His) is the recombinant human-derived Hemopexin protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Hemopexin Protein, Human (HEK293, C-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hemopexin-protein-human-hek293-c-his.html

Purity

98.00

Smiles

TPLPPTSAHGNVAEGETKPDPDVTERCSDGWSFDATTLDDNGTMLFFKGEFVWKSHKWDRELISERWKNFPSPVDAAFRQGHNSVFLIKGDKVWVYPPEKKEKGYPKLLQDEFPGIPSPLDAAVECHRGECQAEGVLFFQGDREWFWDLATGTMKERSWPAVGNCSSALRWLGRYYCFQGNQFLRFDPVRGEVPPRYPRDVRDYFMPCPGRGHGHRNGTGHGNSTHHGPEYMRCSPHLVLSALTSDNHGATYAFSGTHYWRLDTSRDGWHSWPIAHQWPQGPSAVDAAFSWEEKLYLVQGTQVYVFLTKGGYTLVSGYPKRLEKEVGTPHGIILDSVDAAFICPGSSRLHIMAGRRLWWLDLKSGAQATWTELPWPHEKVDGALCMEKSLGPNSCSANGPGLYLIHGPNLYCYSDVEKLNAAKALPQPQNVTSLLGCTH

Molecular Formula

3263 (Gene_ID) P02790 (T24-H462) (Accession)

Molecular Weight

Approximately 60-90 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ProSAAS (PCSK1N) Human siRNA Oligo Duplex (Locus ID 27344)
SR323872 1 Kit

ProSAAS (PCSK1N) Human siRNA Oligo Duplex (Locus ID 27344)

Sign In for Pricing
View Details
Recombinant Mycoplasma Pneumoniae grpE Protein (aa.1-217)
VAng-Lsx04736-500gEcoli 500 µg (E. coli)

Recombinant Mycoplasma Pneumoniae grpE Protein (aa.1-217)

Sign In for Pricing
View Details
IgG2, Fc (AP) discontinued
I1904-83-AP 100 µL

IgG2, Fc (AP) discontinued

Sign In for Pricing
View Details
P-Hydroxybenzyl alcohol discontinued
371784 5 mg

P-Hydroxybenzyl alcohol discontinued

Sign In for Pricing
View Details
NFATC4 Antibody
MBS8586695-01 0.1 mg

NFATC4 Antibody

Sign In for Pricing
View Details
NFATC4 Antibody
MBS8586695-02 0.1 mL (AF405L)

NFATC4 Antibody

Sign In for Pricing
View Details