Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hemopexin, Human (HEK293, His)

Hemopexin Protein efficiently binds and transports heme to the liver for degradation, recovering iron. After this essential process, Hemopexin seamlessly re-enters circulation. It also interacts with FLVCR1, playing a multifaceted role in heme metabolism and iron homeostasis. Hemopexin Protein, Human (HEK293, His) is the recombinant human-derived Hemopexin protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Hemopexin Protein, Human (HEK293, C-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hemopexin-protein-human-hek293-c-his.html

Purity

98.00

Smiles

TPLPPTSAHGNVAEGETKPDPDVTERCSDGWSFDATTLDDNGTMLFFKGEFVWKSHKWDRELISERWKNFPSPVDAAFRQGHNSVFLIKGDKVWVYPPEKKEKGYPKLLQDEFPGIPSPLDAAVECHRGECQAEGVLFFQGDREWFWDLATGTMKERSWPAVGNCSSALRWLGRYYCFQGNQFLRFDPVRGEVPPRYPRDVRDYFMPCPGRGHGHRNGTGHGNSTHHGPEYMRCSPHLVLSALTSDNHGATYAFSGTHYWRLDTSRDGWHSWPIAHQWPQGPSAVDAAFSWEEKLYLVQGTQVYVFLTKGGYTLVSGYPKRLEKEVGTPHGIILDSVDAAFICPGSSRLHIMAGRRLWWLDLKSGAQATWTELPWPHEKVDGALCMEKSLGPNSCSANGPGLYLIHGPNLYCYSDVEKLNAAKALPQPQNVTSLLGCTH

Molecular Formula

3263 (Gene_ID) P02790 (T24-H462) (Accession)

Molecular Weight

Approximately 60-90 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

APOC3 Polyclonal Antibody
RD266214A-01 60 μL

APOC3 Polyclonal Antibody

Sign In for Pricing
View Details
APOC3 Polyclonal Antibody
RD266214A-02 120 μL

APOC3 Polyclonal Antibody

Sign In for Pricing
View Details
APOC3 Polyclonal Antibody
RD266214A-03 200 µL

APOC3 Polyclonal Antibody

Sign In for Pricing
View Details
Human Retinoid-related orphan receptors alpha (RORα) ELISA Kit
YP-W100925-01 48 Tests

Human Retinoid-related orphan receptors alpha (RORα) ELISA Kit

Sign In for Pricing
View Details
Human Retinoid-related orphan receptors alpha (RORα) ELISA Kit
YP-W100925-02 96 Tests

Human Retinoid-related orphan receptors alpha (RORα) ELISA Kit

Sign In for Pricing
View Details
RALA+RALB Polyclonal Antibody, PerCP Conjugated
bs-6170R-PerCP 100 µL

RALA+RALB Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details