Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hemopexin, Human (HEK293, His)

Hemopexin Protein efficiently binds and transports heme to the liver for degradation, recovering iron. After this essential process, Hemopexin seamlessly re-enters circulation. It also interacts with FLVCR1, playing a multifaceted role in heme metabolism and iron homeostasis. Hemopexin Protein, Human (HEK293, His) is the recombinant human-derived Hemopexin protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Hemopexin Protein, Human (HEK293, C-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hemopexin-protein-human-hek293-c-his.html

Purity

98.00

Smiles

TPLPPTSAHGNVAEGETKPDPDVTERCSDGWSFDATTLDDNGTMLFFKGEFVWKSHKWDRELISERWKNFPSPVDAAFRQGHNSVFLIKGDKVWVYPPEKKEKGYPKLLQDEFPGIPSPLDAAVECHRGECQAEGVLFFQGDREWFWDLATGTMKERSWPAVGNCSSALRWLGRYYCFQGNQFLRFDPVRGEVPPRYPRDVRDYFMPCPGRGHGHRNGTGHGNSTHHGPEYMRCSPHLVLSALTSDNHGATYAFSGTHYWRLDTSRDGWHSWPIAHQWPQGPSAVDAAFSWEEKLYLVQGTQVYVFLTKGGYTLVSGYPKRLEKEVGTPHGIILDSVDAAFICPGSSRLHIMAGRRLWWLDLKSGAQATWTELPWPHEKVDGALCMEKSLGPNSCSANGPGLYLIHGPNLYCYSDVEKLNAAKALPQPQNVTSLLGCTH

Molecular Formula

3263 (Gene_ID) P02790 (T24-H462) (Accession)

Molecular Weight

Approximately 60-90 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tanespimycin (17-AAG) Liposomes, Formulation XT28.1
DLL-0011-10ML 10mL

Tanespimycin (17-AAG) Liposomes, Formulation XT28.1

Sign In for Pricing
View Details
Syt8 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3964308 1.0 µg DNA

Syt8 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
SIM2 (Single-minded Homolog 2, Class E Basic Helix-loop-helix Protein 15, bHLHe15, BHLHE15)
S1013-50 100 µg

SIM2 (Single-minded Homolog 2, Class E Basic Helix-loop-helix Protein 15, bHLHe15, BHLHE15)

Sign In for Pricing
View Details
CETP siRNA (Human)
CRH0772-01 15 nmol

CETP siRNA (Human)

Sign In for Pricing
View Details
CETP siRNA (Human)
CRH0772-02 30 nmol

CETP siRNA (Human)

Sign In for Pricing
View Details
Mouse Matrix metallopeptidase 7 (MMP7) ELISA Kit
AE63240MO-01 48 Tests

Mouse Matrix metallopeptidase 7 (MMP7) ELISA Kit

Sign In for Pricing
View Details