Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hemopexin, Human (HEK293, His)

Hemopexin Protein efficiently binds and transports heme to the liver for degradation, recovering iron. After this essential process, Hemopexin seamlessly re-enters circulation. It also interacts with FLVCR1, playing a multifaceted role in heme metabolism and iron homeostasis. Hemopexin Protein, Human (HEK293, His) is the recombinant human-derived Hemopexin protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Hemopexin Protein, Human (HEK293, C-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hemopexin-protein-human-hek293-c-his.html

Purity

98.00

Smiles

TPLPPTSAHGNVAEGETKPDPDVTERCSDGWSFDATTLDDNGTMLFFKGEFVWKSHKWDRELISERWKNFPSPVDAAFRQGHNSVFLIKGDKVWVYPPEKKEKGYPKLLQDEFPGIPSPLDAAVECHRGECQAEGVLFFQGDREWFWDLATGTMKERSWPAVGNCSSALRWLGRYYCFQGNQFLRFDPVRGEVPPRYPRDVRDYFMPCPGRGHGHRNGTGHGNSTHHGPEYMRCSPHLVLSALTSDNHGATYAFSGTHYWRLDTSRDGWHSWPIAHQWPQGPSAVDAAFSWEEKLYLVQGTQVYVFLTKGGYTLVSGYPKRLEKEVGTPHGIILDSVDAAFICPGSSRLHIMAGRRLWWLDLKSGAQATWTELPWPHEKVDGALCMEKSLGPNSCSANGPGLYLIHGPNLYCYSDVEKLNAAKALPQPQNVTSLLGCTH

Molecular Formula

3263 (Gene_ID) P02790 (T24-H462) (Accession)

Molecular Weight

Approximately 60-90 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SH2 domain-containing protein 1A, SH2D1A ELISA KIT
ELI-19207h 96 Tests

Human SH2 domain-containing protein 1A, SH2D1A ELISA KIT

Sign In for Pricing
View Details
MCM9 (NM_017696) Human Tagged Lenti ORF Clone
RC231470L4 10 µg

MCM9 (NM_017696) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CHRNA10 3'UTR Luciferase Stable Cell Line
TU004399 1.0 mL

CHRNA10 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Astn2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4896406 1.0 µg DNA

Astn2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Recombinant Human HDAC3 Protein (His & GST Tag)
PKSH031105 50 µg

Recombinant Human HDAC3 Protein (His & GST Tag)

Sign In for Pricing
View Details
HTR3C Polyclonal Antibody
RD77859A-01 20 µL

HTR3C Polyclonal Antibody

Sign In for Pricing
View Details