Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNase1L3, Mouse (His)

DNase1L3 protein has DNA hydrolytic activity and can effectively cleave single-stranded and double-stranded DNA to generate 3'-OH terminal fragments. It cleaves chromatin into nucleosomal units and participates in internucleosomal DNA fragmentation during apoptosis and necrosis. DNase1L3 Protein, Mouse (His) is the recombinant mouse-derived DNase1L3 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

DNase1L3 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dnase1l3-protein-mouse-his.html

Purity

95.00

Smiles

LRLCSFNVRSFGASKKENHEAMDIIVKIIKRCDLILLMEIKDSSNNICPMLMEKLNGNSRRSTTYNYVISSRLGRNTYKEQYAFVYKEKLVSVKTKYHYHDYQDGDTDVFSREPFVVWFHSPFTAVKDFVIVPLHTTPETSVKEIDELVDVYTDVRSQWKTENFIFMGDFNAGCSYVPKKAWQNIRLRTDPKFVWLIGDQEDTTVKKSTSCAYDRIVLCGQEIVNSVVPRSSGVFDFQKAYDLSEEEALDVSDHFPVEFKLQSSRAFTNNRKSVSLKKRKKGNRS

Molecular Formula

13421 (Gene_ID) O55070 (L26-S310) (Accession)

Molecular Weight

Approximately 42 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Immunoglobulin G3 ELISA Kit
MBS7258807-01 48 Well

Goat Immunoglobulin G3 ELISA Kit

Sign In for Pricing
View Details
Goat Immunoglobulin G3 ELISA Kit
MBS7258807-02 96 Well

Goat Immunoglobulin G3 ELISA Kit

Sign In for Pricing
View Details
Goat Immunoglobulin G3 ELISA Kit
MBS7258807-03 5x 96 Well

Goat Immunoglobulin G3 ELISA Kit

Sign In for Pricing
View Details
Goat Immunoglobulin G3 ELISA Kit
MBS7258807-04 10x 96 Well

Goat Immunoglobulin G3 ELISA Kit

Sign In for Pricing
View Details
EPS15L1 cDNA Clone
MBS1267600-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

EPS15L1 cDNA Clone

Sign In for Pricing
View Details
EPS15L1 cDNA Clone
MBS1267600-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

EPS15L1 cDNA Clone

Sign In for Pricing
View Details