PD-L1, Rat (221a.a, HEK293, His)

PD-L1 Protein is a type I transmembrane protein that belongs to the immunoglobulin (Ig) superfamily. PD-L1 can interact with PD-1, and PD-1/PD-L1 axis is responsible for T cell activation, proliferation, and cytotoxic secretion in cancer, and regulates anti-tumor immune responses. PD-L1 plays a major role in suppressing the adaptive arm of immune systems[1][2][3]. PD-L1 Protein, Rat (221a.a, HEK293, His) is the recombinant rat-derived PD-L1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of PD-L1 Protein, Rat (221a.a, HEK293, His) is 221 a.a., with molecular weight of 40-60 kDa.

AFTITAPKDLYVVEYGSNVTMECRFPVEQKLDLLALVVYWEKEDKEVIQFVEGEEDLKPQHSSFRGRAFLPKDQLLKGNAVLQITDVKLQDAGVYCCMISYGGADYKRITLKVNAPYRKINQRISMDPATSEHELMCQAEGYPEAEVIWTNSDHQSLSGETTVTTSQTEEKLLNVTSVLRVNATANDVFHCTFWRVHSGENHTAELIIPELPVPRLPHNRT