PD-L1, Rat (221a.a, HEK293, His)
Product Specifications
UNSPSC Description
PD-L1 Protein is a type I transmembrane protein that belongs to the immunoglobulin (Ig) superfamily. PD-L1 can interact with PD-1, and PD-1/PD-L1 axis is responsible for T cell activation, proliferation, and cytotoxic secretion in cancer, and regulates anti-tumor immune responses. PD-L1 plays a major role in suppressing the adaptive arm of immune systems[1][2][3]. PD-L1 Protein, Rat (221a.a, HEK293, His) is the recombinant rat-derived PD-L1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of PD-L1 Protein, Rat (221a.a, HEK293, His) is 221 a.a., with molecular weight of 40-60 kDa.
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/pd-l1-protein-rattus-norvegicus.html
Purity
98.0
Smiles
AFTITAPKDLYVVEYGSNVTMECRFPVEQKLDLLALVVYWEKEDKEVIQFVEGEEDLKPQHSSFRGRAFLPKDQLLKGNAVLQITDVKLQDAGVYCCMISYGGADYKRITLKVNAPYRKINQRISMDPATSEHELMCQAEGYPEAEVIWTNSDHQSLSGETTVTTSQTEEKLLNVTSVLRVNATANDVFHCTFWRVHSGENHTAELIIPELPVPRLPHNRT
Molecular Weight
40-60 kDa
Shipping Conditions
Blue Ice
Storage Conditions
Stored at -20°C for 2 years
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog