Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGB1/HMG-1, Human (His)

The multifunctional and redox-sensitive HMGB1/HMG-1 protein plays multiple roles in cellular compartments. In the nucleus, it serves as a major chromatin-associated non-histone protein involved in key processes such as replication, transcription, chromatin remodeling, V (D) J recombination, DNA repair, and genome stability. HMGB1/HMG-1 Protein, Human (His) is the recombinant human-derived HMGB1/HMG-1 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HMGB1/HMG-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hmgb1-hmg-1-protein-human-his.html

Purity

95.00

Smiles

MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE

Molecular Formula

3146 (Gene_ID) P09429 (M1-E215) (Accession)

Molecular Weight

26.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carbonic anhydrase X (CA10) (NM_001082533) Human Recombinant Protein
PH37533M5 20 µg

Carbonic anhydrase X (CA10) (NM_001082533) Human Recombinant Protein

Sign In for Pricing
View Details
SOX21 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
45143111 3x 1.0 µg

SOX21 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
RT1-T18 ORF Vector (Rat) (pORF)
ORF075730 1.0 µg DNA

RT1-T18 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
MCT2 (Monocarboxylate Transporter 2, MCT 2, Solute Carrier Family 16 Member 7, SLC16A7)
M4470-12C 100 µg

MCT2 (Monocarboxylate Transporter 2, MCT 2, Solute Carrier Family 16 Member 7, SLC16A7)

Sign In for Pricing
View Details
Recombinant Human CHST11 Protein - (Dry Ice)
H00050515-Q01-10ug 10 µg

Recombinant Human CHST11 Protein - (Dry Ice)

Sign In for Pricing
View Details
α-Amylase/α-Glucosidase-IN-2
MF-0046246-01 25 mg

α-Amylase/α-Glucosidase-IN-2

Sign In for Pricing
View Details