Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGB1/HMG-1, Human (His)

The multifunctional and redox-sensitive HMGB1/HMG-1 protein plays multiple roles in cellular compartments. In the nucleus, it serves as a major chromatin-associated non-histone protein involved in key processes such as replication, transcription, chromatin remodeling, V (D) J recombination, DNA repair, and genome stability. HMGB1/HMG-1 Protein, Human (His) is the recombinant human-derived HMGB1/HMG-1 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HMGB1/HMG-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hmgb1-hmg-1-protein-human-his.html

Purity

95.00

Smiles

MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE

Molecular Formula

3146 (Gene_ID) P09429 (M1-E215) (Accession)

Molecular Weight

26.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal (IgG) to Human FPR1 / FPR
MBS247556-01 0.05 mL

Rabbit Polyclonal (IgG) to Human FPR1 / FPR

Request Quote
View Details
Rabbit Polyclonal (IgG) to Human FPR1 / FPR
MBS247556-02 5x 0.05 mL

Rabbit Polyclonal (IgG) to Human FPR1 / FPR

Request Quote
View Details
Acad9 (NM_181768) Rat Tagged ORF Clone
RR215382 10 µg

Acad9 (NM_181768) Rat Tagged ORF Clone

Request Quote
View Details
MAD2 (107-276-3)
sc-65492 200 µg/mL

MAD2 (107-276-3)

Request Quote
View Details
PPM1D Human Gene Knockout Kit (CRISPR)
KN209328BN 1 Kit

PPM1D Human Gene Knockout Kit (CRISPR)

Request Quote
View Details
Rat Vitamin E,VE ELISA KIT
JOT-EK0617Ra 96 wells

Rat Vitamin E,VE ELISA KIT

Request Quote
View Details