Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGB1/HMG-1, Human (His)

The multifunctional and redox-sensitive HMGB1/HMG-1 protein plays multiple roles in cellular compartments. In the nucleus, it serves as a major chromatin-associated non-histone protein involved in key processes such as replication, transcription, chromatin remodeling, V (D) J recombination, DNA repair, and genome stability. HMGB1/HMG-1 Protein, Human (His) is the recombinant human-derived HMGB1/HMG-1 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HMGB1/HMG-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hmgb1-hmg-1-protein-human-his.html

Purity

95.00

Smiles

MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE

Molecular Formula

3146 (Gene_ID) P09429 (M1-E215) (Accession)

Molecular Weight

26.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LMWH (Low Molecular Weight Heparin) Guinea Pig ELISA Kit
E7247 96 Tests

LMWH (Low Molecular Weight Heparin) Guinea Pig ELISA Kit

Sign In for Pricing
View Details
SLC2A8 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
44106066 1.0 µg DNA

SLC2A8 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
DLL4 Protein (N-His, Human)
P503227 100 µg

DLL4 Protein (N-His, Human)

Sign In for Pricing
View Details
Rabbit Polyclonal NT5DC2 Antibody
NBP1-70660 100 µL

Rabbit Polyclonal NT5DC2 Antibody

Sign In for Pricing
View Details
Goosecoid Homeobox 2 (GSC2) Cell ELISA Kit
abx595659 96 Tests

Goosecoid Homeobox 2 (GSC2) Cell ELISA Kit

Sign In for Pricing
View Details
Mouse monoclonal antibody to human BDNF, clone 3C11
327-100-01 100 µg

Mouse monoclonal antibody to human BDNF, clone 3C11

Sign In for Pricing
View Details