Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGB1/HMG-1, Human (His)

The multifunctional and redox-sensitive HMGB1/HMG-1 protein plays multiple roles in cellular compartments. In the nucleus, it serves as a major chromatin-associated non-histone protein involved in key processes such as replication, transcription, chromatin remodeling, V (D) J recombination, DNA repair, and genome stability. HMGB1/HMG-1 Protein, Human (His) is the recombinant human-derived HMGB1/HMG-1 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HMGB1/HMG-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hmgb1-hmg-1-protein-human-his.html

Purity

95.00

Smiles

MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE

Molecular Formula

3146 (Gene_ID) P09429 (M1-E215) (Accession)

Molecular Weight

26.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zscan12 Mouse siRNA Oligo Duplex (Locus ID 22758)
SR416107 1 Kit

Zscan12 Mouse siRNA Oligo Duplex (Locus ID 22758)

Request Quote
View Details
AmMag™ Wand D12
L00778 1 PC

AmMag™ Wand D12

Request Quote
View Details
FRMPD3 Rabbit Polyclonal Antibody
TA306864 100 µg

FRMPD3 Rabbit Polyclonal Antibody

Request Quote
View Details
Rdh16 AAV siRNA Pooled Vector
38769164 1.0 µg

Rdh16 AAV siRNA Pooled Vector

Request Quote
View Details
PE-Linked Polyclonal Antibody to Diacylglycerol Kinase Alpha (DGKa)
MBS2065662-01 0.1 mL

PE-Linked Polyclonal Antibody to Diacylglycerol Kinase Alpha (DGKa)

Request Quote
View Details
PE-Linked Polyclonal Antibody to Diacylglycerol Kinase Alpha (DGKa)
MBS2065662-02 0.2 mL

PE-Linked Polyclonal Antibody to Diacylglycerol Kinase Alpha (DGKa)

Request Quote
View Details