Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGB1/HMG-1, Human (His)

The multifunctional and redox-sensitive HMGB1/HMG-1 protein plays multiple roles in cellular compartments. In the nucleus, it serves as a major chromatin-associated non-histone protein involved in key processes such as replication, transcription, chromatin remodeling, V (D) J recombination, DNA repair, and genome stability. HMGB1/HMG-1 Protein, Human (His) is the recombinant human-derived HMGB1/HMG-1 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HMGB1/HMG-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hmgb1-hmg-1-protein-human-his.html

Purity

95.00

Smiles

MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE

Molecular Formula

3146 (Gene_ID) P09429 (M1-E215) (Accession)

Molecular Weight

26.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIR8112 Mouse qPCR Primer Pair (MI0026044)
MP301191 200 Reactions

MIR8112 Mouse qPCR Primer Pair (MI0026044)

Sign In for Pricing
View Details
Ablim1 (NM_001103178) Mouse Untagged Clone
MC218885 10 µg

Ablim1 (NM_001103178) Mouse Untagged Clone

Sign In for Pricing
View Details
TUFM CRISPR Knock Out 293T Cell Line (Human)
48836141 1x 10^6 Cells / 1.0 mL

TUFM CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS525801 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Azurocidin (AZU1) (Center) Rabbit Polyclonal Antibody
AP50321PU-N 400 µL

Azurocidin (AZU1) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human FOXE3 shRNA (UAS) - Lentiviral human FOXE3 shRNA (UAS, RFP) (25)
GTR15079835 1 Vial

Lentiviral human FOXE3 shRNA (UAS) - Lentiviral human FOXE3 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details