Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGB1/HMG-1, Human (His)

The multifunctional and redox-sensitive HMGB1/HMG-1 protein plays multiple roles in cellular compartments. In the nucleus, it serves as a major chromatin-associated non-histone protein involved in key processes such as replication, transcription, chromatin remodeling, V (D) J recombination, DNA repair, and genome stability. HMGB1/HMG-1 Protein, Human (His) is the recombinant human-derived HMGB1/HMG-1 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HMGB1/HMG-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hmgb1-hmg-1-protein-human-his.html

Purity

95.00

Smiles

MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE

Molecular Formula

3146 (Gene_ID) P09429 (M1-E215) (Accession)

Molecular Weight

26.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human EGF R/ErbB1 MAb (Clone 102618)
MAB1095-100 100 µg

Human EGF R/ErbB1 MAb (Clone 102618)

Sign In for Pricing
View Details
SREK1 Antibody
C46433-01 50 μL

SREK1 Antibody

Sign In for Pricing
View Details
SREK1 Antibody
C46433-02 100 µL

SREK1 Antibody

Sign In for Pricing
View Details
MAP3K9, CT (Mitogen-activated Protein Kinase Kinase Kinase 9, MEKK9, Mixed Lineage Kinase 1, MLK1, PRKE1) (MaxLight 550) discontinued
M2350-16C-ML550 100 µL

MAP3K9, CT (Mitogen-activated Protein Kinase Kinase Kinase 9, MEKK9, Mixed Lineage Kinase 1, MLK1, PRKE1) (MaxLight 550) discontinued

Sign In for Pricing
View Details
LOC690806 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV688219 1.0 µg DNA

LOC690806 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Human Uncharacterized protein C5orf56, C5orf56 ELISA KIT
ELI-10408h 96 Tests

Human Uncharacterized protein C5orf56, C5orf56 ELISA KIT

Sign In for Pricing
View Details