Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGB1/HMG-1, Human (His)

The multifunctional and redox-sensitive HMGB1/HMG-1 protein plays multiple roles in cellular compartments. In the nucleus, it serves as a major chromatin-associated non-histone protein involved in key processes such as replication, transcription, chromatin remodeling, V (D) J recombination, DNA repair, and genome stability. HMGB1/HMG-1 Protein, Human (His) is the recombinant human-derived HMGB1/HMG-1 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HMGB1/HMG-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hmgb1-hmg-1-protein-human-his.html

Purity

95.00

Smiles

MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE

Molecular Formula

3146 (Gene_ID) P09429 (M1-E215) (Accession)

Molecular Weight

26.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human DSG1 Protein
E30PQ405 20 µg

Recombinant Human DSG1 Protein

Sign In for Pricing
View Details
Guinea pig glutamate receptor (NMDAR) ELISA Kit
MBS2606656-01 48 Well

Guinea pig glutamate receptor (NMDAR) ELISA Kit

Sign In for Pricing
View Details
Guinea pig glutamate receptor (NMDAR) ELISA Kit
MBS2606656-02 96 Well

Guinea pig glutamate receptor (NMDAR) ELISA Kit

Sign In for Pricing
View Details
Guinea pig glutamate receptor (NMDAR) ELISA Kit
MBS2606656-03 5x 96 Well

Guinea pig glutamate receptor (NMDAR) ELISA Kit

Sign In for Pricing
View Details
Guinea pig glutamate receptor (NMDAR) ELISA Kit
MBS2606656-04 10x 96 Well

Guinea pig glutamate receptor (NMDAR) ELISA Kit

Sign In for Pricing
View Details
Rabbit Monoclonal EGFR Antibody (112)
NBP2-90789-100ul 100 µL

Rabbit Monoclonal EGFR Antibody (112)

Sign In for Pricing
View Details