Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGB1/HMG-1, Human (His)

The multifunctional and redox-sensitive HMGB1/HMG-1 protein plays multiple roles in cellular compartments. In the nucleus, it serves as a major chromatin-associated non-histone protein involved in key processes such as replication, transcription, chromatin remodeling, V (D) J recombination, DNA repair, and genome stability. HMGB1/HMG-1 Protein, Human (His) is the recombinant human-derived HMGB1/HMG-1 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HMGB1/HMG-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hmgb1-hmg-1-protein-human-his.html

Purity

95.00

Smiles

MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE

Molecular Formula

3146 (Gene_ID) P09429 (M1-E215) (Accession)

Molecular Weight

26.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal CD302/CLEC13A Antibody (071)
NBP2-90687-100ul 100 µL

Rabbit Monoclonal CD302/CLEC13A Antibody (071)

Sign In for Pricing
View Details
Research Grade Mecbotamab
MBS1563687-01 0.1 mg

Research Grade Mecbotamab

Sign In for Pricing
View Details
Research Grade Mecbotamab
MBS1563687-02 1 mg

Research Grade Mecbotamab

Sign In for Pricing
View Details
Research Grade Mecbotamab
MBS1563687-03 5x 1 mg

Research Grade Mecbotamab

Sign In for Pricing
View Details
CLEC-16A siRNA (h)
sc-93056 10 µM

CLEC-16A siRNA (h)

Sign In for Pricing
View Details
YWHAG discontinued
339910 100 µL

YWHAG discontinued

Sign In for Pricing
View Details