Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGB1/HMG-1, Human (His)

The multifunctional and redox-sensitive HMGB1/HMG-1 protein plays multiple roles in cellular compartments. In the nucleus, it serves as a major chromatin-associated non-histone protein involved in key processes such as replication, transcription, chromatin remodeling, V (D) J recombination, DNA repair, and genome stability. HMGB1/HMG-1 Protein, Human (His) is the recombinant human-derived HMGB1/HMG-1 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HMGB1/HMG-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hmgb1-hmg-1-protein-human-his.html

Purity

95.00

Smiles

MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE

Molecular Formula

3146 (Gene_ID) P09429 (M1-E215) (Accession)

Molecular Weight

26.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Epyc (NM_001108088) Rat Tagged ORF Clone
RR212769 10 µg

Epyc (NM_001108088) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Human Monoclonal HA Tag Antibody (RMH02) [DyLight 550]
NBP3-26050R 0.1 mL

Human Monoclonal HA Tag Antibody (RMH02) [DyLight 550]

Sign In for Pricing
View Details
E2F5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3B7]
TA810673BM 100 µL

E2F5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3B7]

Sign In for Pricing
View Details
EDG1 Antibody, mAb, Rabbit
A03540-100 100 µL

EDG1 Antibody, mAb, Rabbit

Sign In for Pricing
View Details
OR10H5, CT (OR10H5, Olfactory receptor 10H5, Olfactory receptor OR19-25, Olfactory receptor OR19-26) (FITC) discontinued
039308-FITC 200 µL

OR10H5, CT (OR10H5, Olfactory receptor 10H5, Olfactory receptor OR19-25, Olfactory receptor OR19-26) (FITC) discontinued

Sign In for Pricing
View Details
Nitrobenzene-d5
TRC-N493002-10G 10 g

Nitrobenzene-d5

Sign In for Pricing
View Details