Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGB1/HMG-1, Human (His)

The multifunctional and redox-sensitive HMGB1/HMG-1 protein plays multiple roles in cellular compartments. In the nucleus, it serves as a major chromatin-associated non-histone protein involved in key processes such as replication, transcription, chromatin remodeling, V (D) J recombination, DNA repair, and genome stability. HMGB1/HMG-1 Protein, Human (His) is the recombinant human-derived HMGB1/HMG-1 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HMGB1/HMG-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hmgb1-hmg-1-protein-human-his.html

Purity

95.00

Smiles

MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE

Molecular Formula

3146 (Gene_ID) P09429 (M1-E215) (Accession)

Molecular Weight

26.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HMGXB4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0974008 1.0 µg DNA

HMGXB4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Lentiviral mouse Eloa shRNA (UAS) - Lentiviral mouse Eloa shRNA (UAS, RFP) plasmid
GTR15302560 1 Vial

Lentiviral mouse Eloa shRNA (UAS) - Lentiviral mouse Eloa shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Landiolol Impurity 35
RM-L011435-01 10 mg

Landiolol Impurity 35

Sign In for Pricing
View Details
Landiolol Impurity 35
RM-L011435-02 25 mg

Landiolol Impurity 35

Sign In for Pricing
View Details
Landiolol Impurity 35
RM-L011435-03 50 mg

Landiolol Impurity 35

Sign In for Pricing
View Details
Landiolol Impurity 35
RM-L011435-04 100 mg

Landiolol Impurity 35

Sign In for Pricing
View Details