Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGB1/HMG-1, Human (His)

The multifunctional and redox-sensitive HMGB1/HMG-1 protein plays multiple roles in cellular compartments. In the nucleus, it serves as a major chromatin-associated non-histone protein involved in key processes such as replication, transcription, chromatin remodeling, V (D) J recombination, DNA repair, and genome stability. HMGB1/HMG-1 Protein, Human (His) is the recombinant human-derived HMGB1/HMG-1 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HMGB1/HMG-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hmgb1-hmg-1-protein-human-his.html

Purity

95.00

Smiles

MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE

Molecular Formula

3146 (Gene_ID) P09429 (M1-E215) (Accession)

Molecular Weight

26.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CD121b/IL1R2/IL-2R beta Antibody
E55A14152 100 µg

Human CD121b/IL1R2/IL-2R beta Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Parathyroid gland
CR559547 5 µg

Tissue Total RNA, Parathyroid gland

Sign In for Pricing
View Details
THAP5 siRNA Oligos set (Human)
46633171 3x 5 nmol

THAP5 siRNA Oligos set (Human)

Sign In for Pricing
View Details
RPS27AP7 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
42368111 3x 1.0 µg

RPS27AP7 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Rabbit Heat Shock Protein 90,HSP-90 ELISA Kit
CN-00634R1 96T

Rabbit Heat Shock Protein 90,HSP-90 ELISA Kit

Sign In for Pricing
View Details
COG4 Recombinant Protein (Human)
RP007585 100 µg

COG4 Recombinant Protein (Human)

Sign In for Pricing
View Details