Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGB1/HMG-1, Human (His)

The multifunctional and redox-sensitive HMGB1/HMG-1 protein plays multiple roles in cellular compartments. In the nucleus, it serves as a major chromatin-associated non-histone protein involved in key processes such as replication, transcription, chromatin remodeling, V (D) J recombination, DNA repair, and genome stability. HMGB1/HMG-1 Protein, Human (His) is the recombinant human-derived HMGB1/HMG-1 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HMGB1/HMG-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hmgb1-hmg-1-protein-human-his.html

Purity

95.00

Smiles

MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE

Molecular Formula

3146 (Gene_ID) P09429 (M1-E215) (Accession)

Molecular Weight

26.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tcf23 (NM_053085) Mouse Tagged ORF Clone
MG216995 10 µg

Tcf23 (NM_053085) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
6,10-Dihydroxy Buspirone-d8
009933 1 mg

6,10-Dihydroxy Buspirone-d8

Sign In for Pricing
View Details
Lentiviral human C20orf203 sgRNA gene knockout kit - Lentiviral human C20orf203 sgRNA gene knockout kit (plasmid)
GTR15399710 1 Vial

Lentiviral human C20orf203 sgRNA gene knockout kit - Lentiviral human C20orf203 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Dpf2 (Zinc Finger Protein ubi-d4, Apoptosis Response Zinc Finger Protein, BRG1-Associated Factor 45D, BAF45D, D4, Zinc and double PHD Fingers Family 2, Protein Requiem, Dpf2, Baf45d, Req, Ubid4) (MaxLight 490)
MBS6455596-01 0.1 mL

Dpf2 (Zinc Finger Protein ubi-d4, Apoptosis Response Zinc Finger Protein, BRG1-Associated Factor 45D, BAF45D, D4, Zinc and double PHD Fingers Family 2, Protein Requiem, Dpf2, Baf45d, Req, Ubid4) (MaxLight 490)

Sign In for Pricing
View Details
Dpf2 (Zinc Finger Protein ubi-d4, Apoptosis Response Zinc Finger Protein, BRG1-Associated Factor 45D, BAF45D, D4, Zinc and double PHD Fingers Family 2, Protein Requiem, Dpf2, Baf45d, Req, Ubid4) (MaxLight 490)
MBS6455596-02 5x 0.1 mL

Dpf2 (Zinc Finger Protein ubi-d4, Apoptosis Response Zinc Finger Protein, BRG1-Associated Factor 45D, BAF45D, D4, Zinc and double PHD Fingers Family 2, Protein Requiem, Dpf2, Baf45d, Req, Ubid4) (MaxLight 490)

Sign In for Pricing
View Details
SP7 rabbit pAb
ES9278-01 50 µL

SP7 rabbit pAb

Sign In for Pricing
View Details