Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGB1/HMG-1, Human (His)

The multifunctional and redox-sensitive HMGB1/HMG-1 protein plays multiple roles in cellular compartments. In the nucleus, it serves as a major chromatin-associated non-histone protein involved in key processes such as replication, transcription, chromatin remodeling, V (D) J recombination, DNA repair, and genome stability. HMGB1/HMG-1 Protein, Human (His) is the recombinant human-derived HMGB1/HMG-1 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HMGB1/HMG-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hmgb1-hmg-1-protein-human-his.html

Purity

95.00

Smiles

MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE

Molecular Formula

3146 (Gene_ID) P09429 (M1-E215) (Accession)

Molecular Weight

26.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sorbs3 sgRNA CRISPR Lentivector set (Mouse)
K3410601 3x 1.0 µg

Sorbs3 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Human CD19 Protein, His Tag
KMPH3397 20 µg

Human CD19 Protein, His Tag

Sign In for Pricing
View Details
Anti-RM27 antibody
STJ190966 200 µl

Anti-RM27 antibody

Sign In for Pricing
View Details
Phospho-ErbB 2 Antibody BIOTIN
MBS543808-01 0.1 mg

Phospho-ErbB 2 Antibody BIOTIN

Sign In for Pricing
View Details
Phospho-ErbB 2 Antibody BIOTIN
MBS543808-02 5x 0.1 mg

Phospho-ErbB 2 Antibody BIOTIN

Sign In for Pricing
View Details
pLV3-U6-PSIP1-sgRNA1-Cas9-EGFP-Puro Plasmid
PVT49395 2 µg

pLV3-U6-PSIP1-sgRNA1-Cas9-EGFP-Puro Plasmid

Sign In for Pricing
View Details