Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGB1/HMG-1, Human (His)

The multifunctional and redox-sensitive HMGB1/HMG-1 protein plays multiple roles in cellular compartments. In the nucleus, it serves as a major chromatin-associated non-histone protein involved in key processes such as replication, transcription, chromatin remodeling, V (D) J recombination, DNA repair, and genome stability. HMGB1/HMG-1 Protein, Human (His) is the recombinant human-derived HMGB1/HMG-1 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HMGB1/HMG-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hmgb1-hmg-1-protein-human-his.html

Purity

95.00

Smiles

MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE

Molecular Formula

3146 (Gene_ID) P09429 (M1-E215) (Accession)

Molecular Weight

26.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBE2D3 Antibody (C-term)
MBS9232108-01 0.1 mL

UBE2D3 Antibody (C-term)

Sign In for Pricing
View Details
UBE2D3 Antibody (C-term)
MBS9232108-02 5x 0.1 mL

UBE2D3 Antibody (C-term)

Sign In for Pricing
View Details
Fmoc-Ser-OH
5-06822 100 g

Fmoc-Ser-OH

Sign In for Pricing
View Details
CD79B (m) -PR
sc-42807-PR 10 µM - 20 µL

CD79B (m) -PR

Sign In for Pricing
View Details
PCDH1 (NM_032420) Human Recombinant Protein
TP313703L 1 mg

PCDH1 (NM_032420) Human Recombinant Protein

Sign In for Pricing
View Details
Mouse Monoclonal Von Willebrand Factor Antibody (SPM577) [Alexa Fluor 647]
NBP2-34810AF647 0.1 mL

Mouse Monoclonal Von Willebrand Factor Antibody (SPM577) [Alexa Fluor 647]

Sign In for Pricing
View Details