Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGB1/HMG-1, Human (His)

The multifunctional and redox-sensitive HMGB1/HMG-1 protein plays multiple roles in cellular compartments. In the nucleus, it serves as a major chromatin-associated non-histone protein involved in key processes such as replication, transcription, chromatin remodeling, V (D) J recombination, DNA repair, and genome stability. HMGB1/HMG-1 Protein, Human (His) is the recombinant human-derived HMGB1/HMG-1 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HMGB1/HMG-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hmgb1-hmg-1-protein-human-his.html

Purity

95.00

Smiles

MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE

Molecular Formula

3146 (Gene_ID) P09429 (M1-E215) (Accession)

Molecular Weight

26.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SDCBP2 ORF Vector (Human) (pORF)
43239011 1.0 µg DNA

SDCBP2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Rabbit Polyclonal Glutathione Peroxidase 3/GPX3 Antibody
NBP1-06398 0.1 mL

Rabbit Polyclonal Glutathione Peroxidase 3/GPX3 Antibody

Sign In for Pricing
View Details
Monkey Deoxyribonuclease I ELISA Kit
MBS031478-01 48 Well

Monkey Deoxyribonuclease I ELISA Kit

Sign In for Pricing
View Details
Monkey Deoxyribonuclease I ELISA Kit
MBS031478-02 96 Well

Monkey Deoxyribonuclease I ELISA Kit

Sign In for Pricing
View Details
Monkey Deoxyribonuclease I ELISA Kit
MBS031478-03 5x 96 Well

Monkey Deoxyribonuclease I ELISA Kit

Sign In for Pricing
View Details
Monkey Deoxyribonuclease I ELISA Kit
MBS031478-04 10x 96 Well

Monkey Deoxyribonuclease I ELISA Kit

Sign In for Pricing
View Details