Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGB1/HMG-1, Human (His)

The multifunctional and redox-sensitive HMGB1/HMG-1 protein plays multiple roles in cellular compartments. In the nucleus, it serves as a major chromatin-associated non-histone protein involved in key processes such as replication, transcription, chromatin remodeling, V (D) J recombination, DNA repair, and genome stability. HMGB1/HMG-1 Protein, Human (His) is the recombinant human-derived HMGB1/HMG-1 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HMGB1/HMG-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hmgb1-hmg-1-protein-human-his.html

Purity

95.00

Smiles

MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE

Molecular Formula

3146 (Gene_ID) P09429 (M1-E215) (Accession)

Molecular Weight

26.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

VTI1B (NM_006370) Human Over-expression Lysate
LC416689 20 µg

VTI1B (NM_006370) Human Over-expression Lysate

Sign In for Pricing
View Details
Rabbit Polyclonal TIS11D Antibody [Alexa Fluor 700]
NBP2-97954AF700 0.1 mL

Rabbit Polyclonal TIS11D Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
Mouse HNRNPD shRNA Plasmid
abx969299-01 150 µg

Mouse HNRNPD shRNA Plasmid

Sign In for Pricing
View Details
Mouse HNRNPD shRNA Plasmid
abx969299-02 300 µg

Mouse HNRNPD shRNA Plasmid

Sign In for Pricing
View Details
SLC9A7 (Sodium/Hydrogen Exchanger 7, Solute Carrier Family 9 (Sodium/Hydrogen Exchanger), Member 7)
492208 100 µL

SLC9A7 (Sodium/Hydrogen Exchanger 7, Solute Carrier Family 9 (Sodium/Hydrogen Exchanger), Member 7)

Sign In for Pricing
View Details
AP1G1 Rabbit Monoclonal Antibody [KD Validation]
E51K61609 40 µL

AP1G1 Rabbit Monoclonal Antibody [KD Validation]

Sign In for Pricing
View Details