Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGB1/HMG-1, Human (His)

The multifunctional and redox-sensitive HMGB1/HMG-1 protein plays multiple roles in cellular compartments. In the nucleus, it serves as a major chromatin-associated non-histone protein involved in key processes such as replication, transcription, chromatin remodeling, V (D) J recombination, DNA repair, and genome stability. HMGB1/HMG-1 Protein, Human (His) is the recombinant human-derived HMGB1/HMG-1 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HMGB1/HMG-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hmgb1-hmg-1-protein-human-his.html

Purity

95.00

Smiles

MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE

Molecular Formula

3146 (Gene_ID) P09429 (M1-E215) (Accession)

Molecular Weight

26.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NPM1P11 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1447808 1.0 µg DNA

NPM1P11 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Anti-DRA antibody
STJ96782 200 µl

Anti-DRA antibody

Sign In for Pricing
View Details
Lentiviral mouse Rtn1 shRNA (UAS) - Lentiviral mouse Rtn1 shRNA (UAS, RFP) (100)
GTR15283896 1 Vial

Lentiviral mouse Rtn1 shRNA (UAS) - Lentiviral mouse Rtn1 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Bovine Immunoglobulin G2,IgG2 ELISA KIT
JOT-EK0425Bo 96 wells

Bovine Immunoglobulin G2,IgG2 ELISA KIT

Sign In for Pricing
View Details
Genome polyprotein Antibody
MBS7152900 Inquire

Genome polyprotein Antibody

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Inner membrane protein ALBINO3, chloroplastic (ALB3), partial
MBS7093775 Inquire

Recombinant Arabidopsis thaliana Inner membrane protein ALBINO3, chloroplastic (ALB3), partial

Sign In for Pricing
View Details