Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGB1/HMG-1, Human (His)

The multifunctional and redox-sensitive HMGB1/HMG-1 protein plays multiple roles in cellular compartments. In the nucleus, it serves as a major chromatin-associated non-histone protein involved in key processes such as replication, transcription, chromatin remodeling, V (D) J recombination, DNA repair, and genome stability. HMGB1/HMG-1 Protein, Human (His) is the recombinant human-derived HMGB1/HMG-1 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HMGB1/HMG-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hmgb1-hmg-1-protein-human-his.html

Purity

95.00

Smiles

MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE

Molecular Formula

3146 (Gene_ID) P09429 (M1-E215) (Accession)

Molecular Weight

26.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Intervertebral disc
CS606839 5x 5 µm

Frozen Tissue Sections, Intervertebral disc

Sign In for Pricing
View Details
ATP-binding cassette sub-family B member 7 mitochondrial (ABCB7) Human ELISA Kit
B7304 96 Tests

ATP-binding cassette sub-family B member 7 mitochondrial (ABCB7) Human ELISA Kit

Sign In for Pricing
View Details
ZNF536 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2712905 3x 1.0 µg

ZNF536 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Chrm4 (NM_007699) Mouse Tagged ORF Clone
MG226527 10 µg

Chrm4 (NM_007699) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
ORAOV1 siRNA (h)
sc-96780 10 µM

ORAOV1 siRNA (h)

Sign In for Pricing
View Details
SIRT1 Monoclonal Antibody
MBS9525091-01 0.05 mL

SIRT1 Monoclonal Antibody

Sign In for Pricing
View Details