Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGB1/HMG-1, Human (His)

The multifunctional and redox-sensitive HMGB1/HMG-1 protein plays multiple roles in cellular compartments. In the nucleus, it serves as a major chromatin-associated non-histone protein involved in key processes such as replication, transcription, chromatin remodeling, V (D) J recombination, DNA repair, and genome stability. HMGB1/HMG-1 Protein, Human (His) is the recombinant human-derived HMGB1/HMG-1 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HMGB1/HMG-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hmgb1-hmg-1-protein-human-his.html

Purity

95.00

Smiles

MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE

Molecular Formula

3146 (Gene_ID) P09429 (M1-E215) (Accession)

Molecular Weight

26.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAK (NM_005906) Human Tagged ORF Clone
RG213532 10 µg

MAK (NM_005906) Human Tagged ORF Clone

Sign In for Pricing
View Details
3-Acetyl-2-oxazolidinone
423616-01 1 g

3-Acetyl-2-oxazolidinone

Sign In for Pricing
View Details
3-Acetyl-2-oxazolidinone
423616-02 5 g

3-Acetyl-2-oxazolidinone

Sign In for Pricing
View Details
OR6M1 (NM_001005325) Human Tagged ORF Clone Lentiviral Particle
RC214544L3V 200 µL

OR6M1 (NM_001005325) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rabbit Polyclonal 14-3-3 Antibody [Alexa Fluor 647]
NBP2-99491AF647 0.1 mL

Rabbit Polyclonal 14-3-3 Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
Agar, USP
MBS635316-01 100 g

Agar, USP

Sign In for Pricing
View Details