Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGB1/HMG-1, Human (His)

The multifunctional and redox-sensitive HMGB1/HMG-1 protein plays multiple roles in cellular compartments. In the nucleus, it serves as a major chromatin-associated non-histone protein involved in key processes such as replication, transcription, chromatin remodeling, V (D) J recombination, DNA repair, and genome stability. HMGB1/HMG-1 Protein, Human (His) is the recombinant human-derived HMGB1/HMG-1 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HMGB1/HMG-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hmgb1-hmg-1-protein-human-his.html

Purity

95.00

Smiles

MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE

Molecular Formula

3146 (Gene_ID) P09429 (M1-E215) (Accession)

Molecular Weight

26.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Mt3 Pre-designed siRNA Set A
SI208776A 1 Each

Rat Mt3 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Saa1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
42960114 3x 1.0 µg

Saa1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
PTHD2, NT (PTCHD2, DISP3, KIAA1337, Patched domain-containing protein 2, Protein dispatched homolog 3) (FITC) discontinued
040635-FITC 200 µL

PTHD2, NT (PTCHD2, DISP3, KIAA1337, Patched domain-containing protein 2, Protein dispatched homolog 3) (FITC) discontinued

Sign In for Pricing
View Details
hsa-miR-4786-3p miRNA Inhibitor
MIH02704 2x 5.0 nmol

hsa-miR-4786-3p miRNA Inhibitor

Sign In for Pricing
View Details
Ccdc181 (NM_001014131) Rat Untagged Clone
RN205104 10 µg

Ccdc181 (NM_001014131) Rat Untagged Clone

Sign In for Pricing
View Details
C1QTNF9
MBS8562628-01 0.2 mL

C1QTNF9

Sign In for Pricing
View Details