Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGB1/HMG-1, Human (His)

The multifunctional and redox-sensitive HMGB1/HMG-1 protein plays multiple roles in cellular compartments. In the nucleus, it serves as a major chromatin-associated non-histone protein involved in key processes such as replication, transcription, chromatin remodeling, V (D) J recombination, DNA repair, and genome stability. HMGB1/HMG-1 Protein, Human (His) is the recombinant human-derived HMGB1/HMG-1 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HMGB1/HMG-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hmgb1-hmg-1-protein-human-his.html

Purity

95.00

Smiles

MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE

Molecular Formula

3146 (Gene_ID) P09429 (M1-E215) (Accession)

Molecular Weight

26.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL7P13 sgRNA CRISPR Lentivector (Human) (Target 1)
K1889902 1.0 µg DNA

RPL7P13 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
STYK1 Protein Vector (Mouse) (pPM-C-His)
PV235101 500 ng

STYK1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Mouse Monoclonal Dicer Antibody (S167-7) [DyLight 350]
NBP2-22415UV 0.1 mL

Mouse Monoclonal Dicer Antibody (S167-7) [DyLight 350]

Sign In for Pricing
View Details
MBD3L3 (NM_001164425) Human Recombinant Protein
PH33209M5 20 µg

MBD3L3 (NM_001164425) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Pseudomonas syringae pv. phaseolicola Glutaminase (glsA)
MBS1373432-01 0.02 mg (E-Coli)

Recombinant Pseudomonas syringae pv. phaseolicola Glutaminase (glsA)

Sign In for Pricing
View Details
Recombinant Pseudomonas syringae pv. phaseolicola Glutaminase (glsA)
MBS1373432-02 0.02 mg (Yeast)

Recombinant Pseudomonas syringae pv. phaseolicola Glutaminase (glsA)

Sign In for Pricing
View Details