Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGB1/HMG-1, Human (His)

The multifunctional and redox-sensitive HMGB1/HMG-1 protein plays multiple roles in cellular compartments. In the nucleus, it serves as a major chromatin-associated non-histone protein involved in key processes such as replication, transcription, chromatin remodeling, V (D) J recombination, DNA repair, and genome stability. HMGB1/HMG-1 Protein, Human (His) is the recombinant human-derived HMGB1/HMG-1 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HMGB1/HMG-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hmgb1-hmg-1-protein-human-his.html

Purity

95.00

Smiles

MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE

Molecular Formula

3146 (Gene_ID) P09429 (M1-E215) (Accession)

Molecular Weight

26.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytochrome P450 24A1 discontinued
312847 100 µL

Cytochrome P450 24A1 discontinued

Sign In for Pricing
View Details
Fgd4 (NM_139234) Mouse Tagged Lenti ORF Clone
MR220026L4 10 µg

Fgd4 (NM_139234) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Constitutive androstane receptor (NR1I3) (NM_001077475) Human Tagged ORF Clone Lentiviral Particle
RC216880L4V 200 µL

Constitutive androstane receptor (NR1I3) (NM_001077475) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
RSF1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2073306 1.0 µg DNA

RSF1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Human Corin ELISA Kit
SEKH-0307-01 48 Tests

Human Corin ELISA Kit

Sign In for Pricing
View Details
Human Corin ELISA Kit
SEKH-0307-02 96 Tests

Human Corin ELISA Kit

Sign In for Pricing
View Details