Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGB1/HMG-1, Human (His)

The multifunctional and redox-sensitive HMGB1/HMG-1 protein plays multiple roles in cellular compartments. In the nucleus, it serves as a major chromatin-associated non-histone protein involved in key processes such as replication, transcription, chromatin remodeling, V (D) J recombination, DNA repair, and genome stability. HMGB1/HMG-1 Protein, Human (His) is the recombinant human-derived HMGB1/HMG-1 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HMGB1/HMG-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hmgb1-hmg-1-protein-human-his.html

Purity

95.00

Smiles

MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE

Molecular Formula

3146 (Gene_ID) P09429 (M1-E215) (Accession)

Molecular Weight

26.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyp3a57 (NM_001100180) Mouse Tagged ORF Clone
MG213984 10 µg

Cyp3a57 (NM_001100180) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
RAET1K CRISPR Knock Out 293T Cell Line (Human)
38443141 1x 10^6 Cells / 1.0 mL

RAET1K CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
LOC502176 Protein Vector (Rat) (pPM-C-His)
PV278973 500 ng

LOC502176 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
DNP (Dinitrophenyl)
DNP-CGG-02Low – 50 mg 50 mg

DNP (Dinitrophenyl)

Sign In for Pricing
View Details
Anti-RPAP2 antibody
PAab07397 100 µg

Anti-RPAP2 antibody

Sign In for Pricing
View Details
4,4-Diethoxy-N,N-diethyl-1-butanamine
TRC-D168970-250MG 250 mg

4,4-Diethoxy-N,N-diethyl-1-butanamine

Sign In for Pricing
View Details