Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGB1/HMG-1, Human (His)

The multifunctional and redox-sensitive HMGB1/HMG-1 protein plays multiple roles in cellular compartments. In the nucleus, it serves as a major chromatin-associated non-histone protein involved in key processes such as replication, transcription, chromatin remodeling, V (D) J recombination, DNA repair, and genome stability. HMGB1/HMG-1 Protein, Human (His) is the recombinant human-derived HMGB1/HMG-1 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HMGB1/HMG-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hmgb1-hmg-1-protein-human-his.html

Purity

95.00

Smiles

MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE

Molecular Formula

3146 (Gene_ID) P09429 (M1-E215) (Accession)

Molecular Weight

26.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PNUTS CRISPR Activation Plasmid (m)
sc-424580-ACT 20 µg

PNUTS CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
CCL17 Antibody (Biotin)
GWB-87FDA8 0.05 mg

CCL17 Antibody (Biotin)

Sign In for Pricing
View Details
Bovine HABP1 ELISA Kit
EBH0042 96 Tests

Bovine HABP1 ELISA Kit

Sign In for Pricing
View Details
Human Kremen protein 2, KREMEN2 ELISA KIT
ELI-43324h 96 Tests

Human Kremen protein 2, KREMEN2 ELISA KIT

Sign In for Pricing
View Details
Recombinant Yersinia pestis bv. Antiqua 3,4-dihydroxy-2-butanone 4-phosphate synthase (ribB)
MBS1236551-01 0.02 mg (E-Coli)

Recombinant Yersinia pestis bv. Antiqua 3,4-dihydroxy-2-butanone 4-phosphate synthase (ribB)

Sign In for Pricing
View Details
Recombinant Yersinia pestis bv. Antiqua 3,4-dihydroxy-2-butanone 4-phosphate synthase (ribB)
MBS1236551-02 0.1 mg (E-Coli)

Recombinant Yersinia pestis bv. Antiqua 3,4-dihydroxy-2-butanone 4-phosphate synthase (ribB)

Sign In for Pricing
View Details