Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGB1/HMG-1, Human (His)

The multifunctional and redox-sensitive HMGB1/HMG-1 protein plays multiple roles in cellular compartments. In the nucleus, it serves as a major chromatin-associated non-histone protein involved in key processes such as replication, transcription, chromatin remodeling, V (D) J recombination, DNA repair, and genome stability. HMGB1/HMG-1 Protein, Human (His) is the recombinant human-derived HMGB1/HMG-1 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HMGB1/HMG-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hmgb1-hmg-1-protein-human-his.html

Purity

95.00

Smiles

MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE

Molecular Formula

3146 (Gene_ID) P09429 (M1-E215) (Accession)

Molecular Weight

26.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Pcsk9 Pre-designed siRNA Set A
SI210185A 1 Each

Rat Pcsk9 Pre-designed siRNA Set A

Sign In for Pricing
View Details
DEC1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2764605 3x 1.0 µg

DEC1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
GDPD3 sgRNA CRISPR Lentivector set (Human)
K0850901 3x 1.0 µg

GDPD3 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Rabbit Polyclonal SPRY1 Antibody [DyLight 755]
NBP2-99516IR 0.1 mL

Rabbit Polyclonal SPRY1 Antibody [DyLight 755]

Sign In for Pricing
View Details
Lithium acetate dihydrate 5M
40121157-2 500 mL

Lithium acetate dihydrate 5M

Sign In for Pricing
View Details
LOC100364813 3'UTR Luciferase Stable Cell Line
TU209265 1.0 mL

LOC100364813 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details