Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGB1/HMG-1, Human (His)

The multifunctional and redox-sensitive HMGB1/HMG-1 protein plays multiple roles in cellular compartments. In the nucleus, it serves as a major chromatin-associated non-histone protein involved in key processes such as replication, transcription, chromatin remodeling, V (D) J recombination, DNA repair, and genome stability. HMGB1/HMG-1 Protein, Human (His) is the recombinant human-derived HMGB1/HMG-1 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HMGB1/HMG-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hmgb1-hmg-1-protein-human-his.html

Purity

95.00

Smiles

MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE

Molecular Formula

3146 (Gene_ID) P09429 (M1-E215) (Accession)

Molecular Weight

26.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF152 Protein Vector (Rat) (pPM-C-HA)
PV301808 500 ng

RNF152 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
CRYGA sgRNA CRISPR Lentivector (Human) (Target 3)
K0512204 1.0 µg DNA

CRYGA sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
SCAP siRNA Oligos set (Human)
43093171 3x 5 nmol

SCAP siRNA Oligos set (Human)

Sign In for Pricing
View Details
5nm Gold Nanoparticles, Alkyne Terminated, OD 50, Dispersion in H2O
CGALK-5-25 0.5 mL

5nm Gold Nanoparticles, Alkyne Terminated, OD 50, Dispersion in H2O

Sign In for Pricing
View Details
Rat Monoclonal Cathepsin 7 Antibody (RM0158-4A12)
NBP2-12424-0.025mg 0.025 mg

Rat Monoclonal Cathepsin 7 Antibody (RM0158-4A12)

Sign In for Pricing
View Details
TBCE Antibody
A36213-100UL 100 µL

TBCE Antibody

Sign In for Pricing
View Details