Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGB1/HMG-1, Human (His)

The multifunctional and redox-sensitive HMGB1/HMG-1 protein plays multiple roles in cellular compartments. In the nucleus, it serves as a major chromatin-associated non-histone protein involved in key processes such as replication, transcription, chromatin remodeling, V (D) J recombination, DNA repair, and genome stability. HMGB1/HMG-1 Protein, Human (His) is the recombinant human-derived HMGB1/HMG-1 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HMGB1/HMG-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hmgb1-hmg-1-protein-human-his.html

Purity

95.00

Smiles

MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE

Molecular Formula

3146 (Gene_ID) P09429 (M1-E215) (Accession)

Molecular Weight

26.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Actr2 (NM_001009268) Rat Tagged ORF Clone Lentiviral Particle
RR207334L3V 200 µL

Actr2 (NM_001009268) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Anti-E2F5 Antibody
MBS8306526-01 0.03 mL

Anti-E2F5 Antibody

Sign In for Pricing
View Details
Anti-E2F5 Antibody
MBS8306526-02 0.05 mL

Anti-E2F5 Antibody

Sign In for Pricing
View Details
Anti-E2F5 Antibody
MBS8306526-03 0.1 mL

Anti-E2F5 Antibody

Sign In for Pricing
View Details
Anti-E2F5 Antibody
MBS8306526-04 0.2 mL

Anti-E2F5 Antibody

Sign In for Pricing
View Details
Anti-E2F5 Antibody
MBS8306526-05 5x 0.2 mL

Anti-E2F5 Antibody

Sign In for Pricing
View Details