Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas syringae pv. tomato Copper resistance protein C (copC)

Product Specifications

Abbreviation

Recombinant Pseudomonas syringae pv. tomato copC protein

Gene Name

CopC

UniProt

P12376

Expression Region

25-126aa

Organism

Pseudomonas syringae pv. tomato

Target Sequence

HPKLVSSTPAEGSEGAAPAKIELHFSENLVTQFSGAKLVMTAMPGMEHSPMAVKAAVSGGGDPKTMVITPASPLTAGTYKVDWRAVSSDTHPITGSVTFKVK

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Mediates copper resistance by sequestration of copper in the periplasm along with the copper-binding protein CopA.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD10 (CB-CALLA), CF514 conjugate, 0.1mg/mL
BNC140146-500 1x 500 µL

CD10 (CB-CALLA), CF514 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF640R conjugate, 0.1mg/mL
BNC401073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF770 conjugate, 0.1mg/mL
BNC700977-100 1x 100 µL

TGF-beta (1D11.16.8), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF405S conjugate, 0.1mg/mL
BNC040977-500 1x 500 µL

TGF-beta (1D11.16.8), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8A (Cytotoxic-&Suppressor T-Cell Marker) (rC8/468), CF568 conjugate, 0.1mg/mL
BNC681867-100 1x 100 µL

CD8A (Cytotoxic-&Suppressor T-Cell Marker) (rC8/468), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF640R conjugate, 0.1mg/mL
BNC400305-100 1x 100 µL

CD95 (B-R18), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details