Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD39L1/ENTPD2, Human (HEK293, His)

CD39L1/ENTPD2 protein, expressed in the nervous system, efficiently hydrolyzes ATP and various nucleotides, while showing limited hydrolysis of ADP. Its substrate specificity hierarchy highlights its regulatory role in purinergic signaling and selective nucleotide hydrolysis, contributing to precise control of neurotransmission. CD39L1/ENTPD2 Protein, Human (HEK293, His) is the recombinant human-derived CD39L1/ENTPD2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD39L1/ENTPD2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd39l1-entpd2-protein-human-hek-293-his.html

Purity

95.0

Smiles

TRDVREPPALKYGIVLDAGSSHTSMFIYKWPADKENDTGIVGQHSSCDVPGGGISSYADNPSGASQSLVGCLEQALQDVPKERHAGTPLYLGATAGMRLLNLTNPEASTSVLMAVTHTLTQYPFDFRGARILSGQEEGVFGWVTANYLLENFIKYGWVGRWFRPRKGTLGAMDLGGASTQITFETTSPAEDRASEVQLHLYGQHYRVYTHSFLCYGRDQVLQRLLASALQTHGFHPCWPRGFSTQVLLGDVYQSPCTMAQRPQNFNSSARVSLSGSSDPHLCRDLVSGLFSFSSCPFSRCSFNGVFQPPVAGNFVAFSAFFYTVDFLRTSMGLPVATLQQLEAAAVNVCNQTWAQLQARVPGQRARLADYCAGAMFVQQLLSRGYGFDERAFGGVIFQKKAADTAVGWALGYMLNLTNLIPADPPGLRKGTD

Molecular Formula

954 (Gene_ID) Q9Y5L3 (T29-D460) (Accession)

Molecular Weight

Approximately 60 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE anti-human CCR10
GT11608 100 Tests

PE anti-human CCR10

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces japonicus Protein get1 (get1)
MBS7015578-01 0.02 mg

Recombinant Schizosaccharomyces japonicus Protein get1 (get1)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces japonicus Protein get1 (get1)
MBS7015578-02 0.1 mg

Recombinant Schizosaccharomyces japonicus Protein get1 (get1)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces japonicus Protein get1 (get1)
MBS7015578-03 5x 0.1 mg

Recombinant Schizosaccharomyces japonicus Protein get1 (get1)

Sign In for Pricing
View Details
Recombinant Vascular Endothelial Growth Factor C (VEGFC)
SIPA089Ca01-01 10 µg

Recombinant Vascular Endothelial Growth Factor C (VEGFC)

Sign In for Pricing
View Details
Recombinant Vascular Endothelial Growth Factor C (VEGFC)
SIPA089Ca01-02 50 µg

Recombinant Vascular Endothelial Growth Factor C (VEGFC)

Sign In for Pricing
View Details