Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free FGF-8a, Human (His)

Animal-Free FGF-8a Protein, Human (His) is the recombinant human-derived animal-FreeFGF-8a protein, expressed by E. coli, with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free FGF-8a Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-fgf-8a-protein-human-his.html

Purity

95.0

Smiles

MQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR

Molecular Formula

2253 (Gene_ID) P55075-2 (Q23-R204) (Accession)

Molecular Weight

Approximately 23 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human PPP1R10 Protein
E30P06723A 50 µg

Recombinant Human PPP1R10 Protein

Sign In for Pricing
View Details
TAS1R1 Rabbit pAb
E45R17788N-50 50 µL

TAS1R1 Rabbit pAb

Sign In for Pricing
View Details
ZBTB22 siRNA (Mouse)
MBS8212632-01 15 nmol

ZBTB22 siRNA (Mouse)

Sign In for Pricing
View Details
ZBTB22 siRNA (Mouse)
MBS8212632-02 30 nmol

ZBTB22 siRNA (Mouse)

Sign In for Pricing
View Details
ZBTB22 siRNA (Mouse)
MBS8212632-03 5x 30 nmol

ZBTB22 siRNA (Mouse)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Fumarylacetoacetate Hydrolase (FAH)
MBS2096562-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Fumarylacetoacetate Hydrolase (FAH)

Sign In for Pricing
View Details