Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A9, Canine (His)

The S100A9 protein is a calcium and zinc binder that plays a critical regulatory role in inflammation and immune responses. Its diverse functions include induction of neutrophil chemotaxis, adhesion, enhanced bactericidal activity through SYK, PI3K/AKT and ERK1/2 activation, and promotion of phagocytosis. S100A9 Protein, Canine (His) is the recombinant canine-derived S100A9 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

S100A9 Protein, Canine (His), Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a9-protein-canine-his.html

Purity

95.00

Smiles

MADQMSQLECSIETIINIFHQYSVRLEHPDKLNQKEMKQLVKKELPNFLKKQKKNDNAINKIMEDLDTNGDKELNFEEFSILVARLTVASHEEMHKNAPEGEGHSHGPGFGEGSQGHCHSHGGHGHGHSH

Molecular Formula

490463 (Gene_ID) A0A8I3MFK0/XP_038528057 (M1-H130) (Accession)

Molecular Weight

Approximately 15.90 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LIMS1 (NM_001193485) Human Over-expression Lysate
LC434199 20 µg

LIMS1 (NM_001193485) Human Over-expression Lysate

Sign In for Pricing
View Details
HSF2 Mouse Monoclonal Antibody [Clone ID: OTI2E11]
CF807435 100 µg

HSF2 Mouse Monoclonal Antibody [Clone ID: OTI2E11]

Sign In for Pricing
View Details
PDK1 (NM_002610) Human Over-expression Lysate
LY400922 100 µg

PDK1 (NM_002610) Human Over-expression Lysate

Sign In for Pricing
View Details
Natural Convection Oven BONC-201
BONC-201 1 Unit

Natural Convection Oven BONC-201

Sign In for Pricing
View Details
1,2-Epoxy-7-octene
TRC-E589940-5G 5 g

1,2-Epoxy-7-octene

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Spike S1 (N234Q) (His Tag)
PKSV030396 100 µg

Recombinant SARS-CoV-2 Spike S1 (N234Q) (His Tag)

Sign In for Pricing
View Details