Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A9, Canine (His)

The S100A9 protein is a calcium and zinc binder that plays a critical regulatory role in inflammation and immune responses. Its diverse functions include induction of neutrophil chemotaxis, adhesion, enhanced bactericidal activity through SYK, PI3K/AKT and ERK1/2 activation, and promotion of phagocytosis. S100A9 Protein, Canine (His) is the recombinant canine-derived S100A9 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

S100A9 Protein, Canine (His), Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a9-protein-canine-his.html

Purity

95.00

Smiles

MADQMSQLECSIETIINIFHQYSVRLEHPDKLNQKEMKQLVKKELPNFLKKQKKNDNAINKIMEDLDTNGDKELNFEEFSILVARLTVASHEEMHKNAPEGEGHSHGPGFGEGSQGHCHSHGGHGHGHSH

Molecular Formula

490463 (Gene_ID) A0A8I3MFK0/XP_038528057 (M1-H130) (Accession)

Molecular Weight

Approximately 15.90 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FKHL18 shRNA Plasmid (h)
sc-75023-SH 20 µg

FKHL18 shRNA Plasmid (h)

Sign In for Pricing
View Details
Recombinant histone H3
MBS483039-01 1 mg

Recombinant histone H3

Sign In for Pricing
View Details
Recombinant histone H3
MBS483039-02 5x 1 mg

Recombinant histone H3

Sign In for Pricing
View Details
Mouse Monoclonal mtTFA Antibody (18G102B2E11) [DyLight 680]
NBP1-71648FR 0.1 mL

Mouse Monoclonal mtTFA Antibody (18G102B2E11) [DyLight 680]

Sign In for Pricing
View Details
Northern Blot Probes :sno234
MP-0510 1 Each

Northern Blot Probes :sno234

Sign In for Pricing
View Details
TWIST Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-2441R-BF555-TR 20 µL

TWIST Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details