Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A9, Canine (His)

The S100A9 protein is a calcium and zinc binder that plays a critical regulatory role in inflammation and immune responses. Its diverse functions include induction of neutrophil chemotaxis, adhesion, enhanced bactericidal activity through SYK, PI3K/AKT and ERK1/2 activation, and promotion of phagocytosis. S100A9 Protein, Canine (His) is the recombinant canine-derived S100A9 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

S100A9 Protein, Canine (His), Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a9-protein-canine-his.html

Purity

95.00

Smiles

MADQMSQLECSIETIINIFHQYSVRLEHPDKLNQKEMKQLVKKELPNFLKKQKKNDNAINKIMEDLDTNGDKELNFEEFSILVARLTVASHEEMHKNAPEGEGHSHGPGFGEGSQGHCHSHGGHGHGHSH

Molecular Formula

490463 (Gene_ID) A0A8I3MFK0/XP_038528057 (M1-H130) (Accession)

Molecular Weight

Approximately 15.90 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gtpbp8 (NM_025332) Mouse Tagged Lenti ORF Clone
MR214079L4 10 µg

Gtpbp8 (NM_025332) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Stool Cell DNA Auto Tube
301391 72 Tests

Stool Cell DNA Auto Tube

Sign In for Pricing
View Details
STFR W026-450x150-AL-CRD/1 AC Signs
830198 Card of 1 Pictogram(s)

STFR W026-450x150-AL-CRD/1 AC Signs

Sign In for Pricing
View Details
NKX1-2, NT (NKX1-2, C10orf121, NKX1.1, NK1 transcription factor-related protein 2, Homeobox protein SAX-1, NKX-1.1) (AP) discontinued
038995-AP 200 µL

NKX1-2, NT (NKX1-2, C10orf121, NKX1.1, NK1 transcription factor-related protein 2, Homeobox protein SAX-1, NKX-1.1) (AP) discontinued

Sign In for Pricing
View Details
Lentiviral mouse Fgfr2 shRNA (UAS) - Lentiviral mouse Fgfr2 shRNA (UAS) (25)
GTR15193013 1 Vial

Lentiviral mouse Fgfr2 shRNA (UAS) - Lentiviral mouse Fgfr2 shRNA (UAS) (25)

Sign In for Pricing
View Details
SERPINH1, ID (Serine/Cysteine Proteinase Inhibitor, Clade H, Member 1, CBP1, CBP2, RA-A47, gp46) r (PE) discontinued
031246-PE 200 µL

SERPINH1, ID (Serine/Cysteine Proteinase Inhibitor, Clade H, Member 1, CBP1, CBP2, RA-A47, gp46) r (PE) discontinued

Sign In for Pricing
View Details