Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PGLYRP1/PGRP-S, Mouse (HEK293, His)

PGLYRP1/PGRP-S Protein plays a vital role in the innate immune response.It recognizes bacterial peptidoglycan and activates antimicrobial defense mechanisms.PGLYRP1/PGRP-S Protein interacts with other immune molecules, enhancing immune responses against bacterial infections.Understanding its functions can aid in developing strategies to combat bacterial pathogens.PGLYRP1/PGRP-S Protein, Mouse (HEK293, His) is the recombinant mouse-derived PGLYRP1/PGRP-S protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

PGLYRP1/PGRP-S Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pglyrp1-pgrp-s-protein-mouse-hek293-his.html

Purity

98.0

Smiles

FIVPRSEWRALPSECSSRLGHPVRYVVISHTAGSFCNSPDSCEQQARNVQHYHKNELGWCDVAYNFLIGEDGHVYEGRGWNIKGDHTGPIWNPMSIGITFMGNFMDRVPAKRALRAALNLLECGVSRGFLRSNYEVKGHRDVQSTLSPGDQLYQVIQSWEHYRE

Molecular Formula

21946 (Gene_ID) O88593 (F19-E182) (Accession)

Molecular Weight

Approximately 18 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (RIV11), CF555 conjugate, 0.1mg/mL
BNC550333-100 1x 100 µL

CD8 (RIV11), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF543 conjugate, 0.1mg/mL
BNC430151-500 1x 500 µL

CD11a (Cris-3), CF543 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF405S conjugate, 0.1mg/mL
BNC041820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF680R conjugate, 0.1mg/mL
BNC810152-500 1x 500 µL

CD11c (HC1/1), CF680R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF640R conjugate, 0.1mg/mL
BNC400226-500 1x 500 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (EGP40/826), CF647 conjugate, 0.1mg/mL
BNC470826-100 1x 100 µL

Ep-CAM / CD326 (EGP40/826), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details