Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine ACA-IgA ELISA Kit

Product Specifications

CAS Number

7732-18-5

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Escherichia coli (strain K12) WECC Polyclonal Antibody
MBS7158833 Inquire

Rabbit anti-Escherichia coli (strain K12) WECC Polyclonal Antibody

Sign In for Pricing
View Details
Anti-RUNX2 (Rabbit, Monoclonal)
A120475 100 µL

Anti-RUNX2 (Rabbit, Monoclonal)

Sign In for Pricing
View Details
SIPA1 Human Pre-designed siRNA Set A
HY-RS12928 1 Set

SIPA1 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Villin Polyclonal Antibody
E11-2035747 100 µg -100 µL

Villin Polyclonal Antibody

Sign In for Pricing
View Details
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
HY-P3431 1 Each

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Sign In for Pricing
View Details
Rat Eotaxin 1 ELISA Kit
MBS722247-01 48 Well

Rat Eotaxin 1 ELISA Kit

Sign In for Pricing
View Details