Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Galectin-3/LGALS3, Human (HEK293, His)

The Galectin-3/LGALS3 protein is a galactose-specific lectin known for its diverse roles in cellular processes. It binds IgE and synergizes with α-3 and β-1 integrins to promote CSPG4-induced endothelial cell migration. Galectin-3/LGALS3 Protein, Human (HEK293, His) is the recombinant human-derived Galectin-3/LGALS3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Galectin-3/LGALS3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/galectin-3-lgals3-protein-human-hek-293-his.html

Purity

98.0

Smiles

ADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYHGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSAPGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI

Molecular Formula

3958 (Gene_ID) AAH53667.1 (A2-I250) (Accession)

Molecular Weight

Approximately 32-40 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD54 / ICAM-1 (15.2), CF647 conjugate, 0.1mg/mL
BNC472853-100 1x 100 µL

CD54 / ICAM-1 (15.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human MRPS28 Protein
ARP3021-01 10 µg

Recombinant Human MRPS28 Protein

Sign In for Pricing
View Details
Recombinant Human MRPS28 Protein
ARP3021-02 50 µg

Recombinant Human MRPS28 Protein

Sign In for Pricing
View Details
Recombinant Human MRPS28 Protein
ARP3021-03 100 µg

Recombinant Human MRPS28 Protein

Sign In for Pricing
View Details
Recombinant Human MRPS28 Protein
ARP3021-04 1 mg

Recombinant Human MRPS28 Protein

Sign In for Pricing
View Details
Human Ras-related protein Rab-5B (RAB5B) ELISA Kit
AE24643HU-01 48 Tests

Human Ras-related protein Rab-5B (RAB5B) ELISA Kit

Sign In for Pricing
View Details