Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AICDA, Mouse (His-Myc)

AICDA Protein, Mouse (His-Myc) is an enzyme that mediates affinity maturation and facilitates DNA demethylation in germinal center (GC) B cells. AICDA Protein overexpression causes more aggressive disease in BCL2-driven murine lymphomas.

Product Specifications

Product Name Alternative

AICDA Protein, Mouse (His-Myc), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/aicda-protein-mouse-his-myc.html

Smiles

MDSLLMKQKKFLYHFKNVRWAKGRHETYLCYVVKRRDSATSCSLDFGHLRNKSGCHVELLFLRYISDWDLDPGRCYRVTWFTSWSPCYDCARHVAEFLRWNPNLSLRIFTARLYFCEDRKAEPEGLRRLHRAGVQIGIMTFKDYFYCWNTFVENRERTFKAWEGLHENSVRLTRQLRRILLPLYEVDDLRDAFRMLGF

Molecular Formula

11628 (Gene_ID) Q9WVE0 (M1-F198) (Accession)

Molecular Weight

Approximately 31.5 kDa

References & Citations

[1]Teater M, et, al. AICDA drives epigenetic heterogeneity and accelerates germinal center-derived lymphomagenesis. Nat Commun. 2018 Jan 15;9 (1) :222.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Axl Lentiviral Activation Particles (m2)
sc-424005-LAC-2 200 µL

Axl Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Polyclonal Antibody to Ghrelin (GHRL)
TRV-0056639-01 20 µL

Polyclonal Antibody to Ghrelin (GHRL)

Sign In for Pricing
View Details
Polyclonal Antibody to Ghrelin (GHRL)
TRV-0056639-02 100 µL

Polyclonal Antibody to Ghrelin (GHRL)

Sign In for Pricing
View Details
Polyclonal Antibody to Ghrelin (GHRL)
TRV-0056639-03 200 µL

Polyclonal Antibody to Ghrelin (GHRL)

Sign In for Pricing
View Details
Polyclonal Antibody to Ghrelin (GHRL)
TRV-0056639-04 1 mL

Polyclonal Antibody to Ghrelin (GHRL)

Sign In for Pricing
View Details
ARHGAP19 Recombinant Protein (Human)
RP001741 100 µg

ARHGAP19 Recombinant Protein (Human)

Sign In for Pricing
View Details