Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free CCL4, Mouse (His)

CCL4 protein, with inflammatory and chemokinetic properties, acts as a monokine and self-associates to form homodimers.Animal-Free CCL4 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeCCL4 protein, expressed by E.coli , with N-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free CCL4 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-ccl4-protein-mouse-his.html

Purity

95.0

Smiles

APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN

Molecular Formula

20303 (Gene_ID) P14097 (A24-N92) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDC34 Polyclonal Antibody
E-AB-60971-01 60 µL

CDC34 Polyclonal Antibody

Sign In for Pricing
View Details
CDC34 Polyclonal Antibody
E-AB-60971-02 120 µL

CDC34 Polyclonal Antibody

Sign In for Pricing
View Details
CDC34 Polyclonal Antibody
E-AB-60971-03 200 µL

CDC34 Polyclonal Antibody

Sign In for Pricing
View Details
PIRC45 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV740602 1.0 µg DNA

PIRC45 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Rabbit Monoclonal LAIR2 Antibody (024)
NBP2-89685-100ul 100 µL

Rabbit Monoclonal LAIR2 Antibody (024)

Sign In for Pricing
View Details
Human Dynamin 2 (DNM2) ELISA Kit
RD-DNM2-Hu-96Tests 96 Tests

Human Dynamin 2 (DNM2) ELISA Kit

Sign In for Pricing
View Details