Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free CCL4, Mouse (His)

CCL4 protein, with inflammatory and chemokinetic properties, acts as a monokine and self-associates to form homodimers.Animal-Free CCL4 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeCCL4 protein, expressed by E.coli , with N-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free CCL4 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-ccl4-protein-mouse-his.html

Purity

95.0

Smiles

APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN

Molecular Formula

20303 (Gene_ID) P14097 (A24-N92) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NT-3 Protein, Tag Free, low endotoxin (HPLC verified)
NT3-H5213-50ug 50 µg

Human NT-3 Protein, Tag Free, low endotoxin (HPLC verified)

Sign In for Pricing
View Details
CCDC78 (NM_001031737) Human Mass Spec Standard
PH308165 10 µg

CCDC78 (NM_001031737) Human Mass Spec Standard

Sign In for Pricing
View Details
BAX (Apoptosis Regulator BAX, Bcl-2-like Protein 4, Bcl2-L-4, BCL2L4) (AP) discontinued
123842-AP 100 µL

BAX (Apoptosis Regulator BAX, Bcl-2-like Protein 4, Bcl2-L-4, BCL2L4) (AP) discontinued

Sign In for Pricing
View Details
GRK 1 (D11) Alexa Fluor® 488
sc-56910 AF488 200 µg/mL

GRK 1 (D11) Alexa Fluor® 488

Sign In for Pricing
View Details
Immunoglobulin superfamily member 5 (IGSF5) Human ELISA Kit
E2415 96 Tests

Immunoglobulin superfamily member 5 (IGSF5) Human ELISA Kit

Sign In for Pricing
View Details
PLV3-CMV-PAFAH1B1-3xMyc-CopGFP-Puro Plasmid
PVT66075 2 µg

PLV3-CMV-PAFAH1B1-3xMyc-CopGFP-Puro Plasmid

Sign In for Pricing
View Details