Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free CCL4, Mouse (His)

CCL4 protein, with inflammatory and chemokinetic properties, acts as a monokine and self-associates to form homodimers.Animal-Free CCL4 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeCCL4 protein, expressed by E.coli , with N-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free CCL4 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-ccl4-protein-mouse-his.html

Purity

95.0

Smiles

APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN

Molecular Formula

20303 (Gene_ID) P14097 (A24-N92) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Retinoid X Receptor gamma (RXRG) (NM_006917) Human Recombinant Protein
TP304093M 100 µg

Retinoid X Receptor gamma (RXRG) (NM_006917) Human Recombinant Protein

Sign In for Pricing
View Details
PRKAB2 (5'-AMP-activated Protein Kinase Subunit beta-2, AMPK Subunit beta-2, MGC61468) (MaxLight 550)
MBS6390622-01 0.1 mL

PRKAB2 (5'-AMP-activated Protein Kinase Subunit beta-2, AMPK Subunit beta-2, MGC61468) (MaxLight 550)

Sign In for Pricing
View Details
PRKAB2 (5'-AMP-activated Protein Kinase Subunit beta-2, AMPK Subunit beta-2, MGC61468) (MaxLight 550)
MBS6390622-02 5x 0.1 mL

PRKAB2 (5'-AMP-activated Protein Kinase Subunit beta-2, AMPK Subunit beta-2, MGC61468) (MaxLight 550)

Sign In for Pricing
View Details
Arl5b (NM_001015031) Rat Tagged ORF Clone Lentiviral Particle
RR214839L3V 200 µL

Arl5b (NM_001015031) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Lentiviral mouse Zgpat shRNA (UAS) - Lentiviral mouse Zgpat shRNA (UAS, GFP) plasmid
GTR15176602 1 Vial

Lentiviral mouse Zgpat shRNA (UAS) - Lentiviral mouse Zgpat shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Sp1 Rabbit Polyclonal Antibody
ES7257-01 50 µL

Sp1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details