Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free CCL4, Mouse (His)

CCL4 protein, with inflammatory and chemokinetic properties, acts as a monokine and self-associates to form homodimers.Animal-Free CCL4 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeCCL4 protein, expressed by E.coli , with N-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free CCL4 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-ccl4-protein-mouse-his.html

Purity

95.0

Smiles

APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN

Molecular Formula

20303 (Gene_ID) P14097 (A24-N92) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ST14 Protein (N-Cleavage, Human)
P528762 100 µg

ST14 Protein (N-Cleavage, Human)

Sign In for Pricing
View Details
Lentiviral mouse Pin4 shRNA (UAS) - Lentiviral mouse Pin4 shRNA (UAS, GFP) (100)
GTR15202953 1 Vial

Lentiviral mouse Pin4 shRNA (UAS) - Lentiviral mouse Pin4 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Recombinant Clostridium Novyi ispE Protein (aa 1-280)
VAng-Lsx9998-50gEcoli 50 µg (E. coli)

Recombinant Clostridium Novyi ispE Protein (aa 1-280)

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa Crossover junction endodeoxyribonuclease RuvC (ruvC)
MBS1164533-01 0.02 mg (E-Coli)

Recombinant Pseudomonas aeruginosa Crossover junction endodeoxyribonuclease RuvC (ruvC)

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa Crossover junction endodeoxyribonuclease RuvC (ruvC)
MBS1164533-02 0.1 mg (E-Coli)

Recombinant Pseudomonas aeruginosa Crossover junction endodeoxyribonuclease RuvC (ruvC)

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa Crossover junction endodeoxyribonuclease RuvC (ruvC)
MBS1164533-03 0.02 mg (Yeast)

Recombinant Pseudomonas aeruginosa Crossover junction endodeoxyribonuclease RuvC (ruvC)

Sign In for Pricing
View Details