Animal-Free CCL4, Mouse (His)
CCL4 protein, with inflammatory and chemokinetic properties, acts as a monokine and self-associates to form homodimers.Animal-Free CCL4 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeCCL4 protein, expressed by E.coli , with N-His labeled tag.This product is for cell culture use only.
Product Specifications
Product Name Alternative
Animal-Free CCL4 Protein, Mouse (His), Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/animal-free-ccl4-protein-mouse-his.html
Purity
95.0
Smiles
APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN
Molecular Formula
20303 (Gene_ID) P14097 (A24-N92) (Accession)
Molecular Weight
Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
K0406, NT (TTI1, KIAA0406, SMG10, TELO2-interacting protein 1 homolog, Protein SMG10) (MaxLight 490) discontinued
Lentiviral human HMCN1 sgRNA gene knockout kit - Lentiviral human HMCN1 sgRNA gene knockout kit (plasmid)
Recombinant Lactobacillus plantarum Peptide chain release factor 2 (prfB)
Recombinant Lactobacillus plantarum Peptide chain release factor 2 (prfB)
Recombinant Lactobacillus plantarum Peptide chain release factor 2 (prfB)