Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free CCL4, Mouse (His)

CCL4 protein, with inflammatory and chemokinetic properties, acts as a monokine and self-associates to form homodimers.Animal-Free CCL4 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeCCL4 protein, expressed by E.coli , with N-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free CCL4 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-ccl4-protein-mouse-his.html

Purity

95.0

Smiles

APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN

Molecular Formula

20303 (Gene_ID) P14097 (A24-N92) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human/Mouse PARP Affinity Purified Polyclonal Ab
AF-600-NA 100 µg

Human/Mouse PARP Affinity Purified Polyclonal Ab

Ask
View Details
Zfp185 Protein Vector (Mouse) (pPM-C-HA)
50867024 500 ng

Zfp185 Protein Vector (Mouse) (pPM-C-HA)

Ask
View Details
Lentiviral human OR6C3 sgRNA gene knockout kit - Lentiviral human OR6C3 sgRNA gene knockout kit (100)
GTR15375292 1 Vial

Lentiviral human OR6C3 sgRNA gene knockout kit - Lentiviral human OR6C3 sgRNA gene knockout kit (100)

Ask
View Details
CLEC1B (C-type Lectin Domain Family 1 Member B, C-type Lectin-like Receptor 2, CLEC-2, CLEC2, UNQ721/PRO1384, 1810061I13Rik, QDED721)
MBS6000533-01 0.1 mg

CLEC1B (C-type Lectin Domain Family 1 Member B, C-type Lectin-like Receptor 2, CLEC-2, CLEC2, UNQ721/PRO1384, 1810061I13Rik, QDED721)

Ask
View Details
CLEC1B (C-type Lectin Domain Family 1 Member B, C-type Lectin-like Receptor 2, CLEC-2, CLEC2, UNQ721/PRO1384, 1810061I13Rik, QDED721)
MBS6000533-02 5x 0.1 mg

CLEC1B (C-type Lectin Domain Family 1 Member B, C-type Lectin-like Receptor 2, CLEC-2, CLEC2, UNQ721/PRO1384, 1810061I13Rik, QDED721)

Ask
View Details
Anti-KDM3B antibody
STJ191751 200 µl

Anti-KDM3B antibody

Ask
View Details