Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free CCL4, Mouse (His)

CCL4 protein, with inflammatory and chemokinetic properties, acts as a monokine and self-associates to form homodimers.Animal-Free CCL4 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeCCL4 protein, expressed by E.coli , with N-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free CCL4 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-ccl4-protein-mouse-his.html

Purity

95.0

Smiles

APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN

Molecular Formula

20303 (Gene_ID) P14097 (A24-N92) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

C20ORF201 (Uncharacterized Protein C20orf201, Chromosome 20 Open Reading Frame 201)
476735 100 µL

C20ORF201 (Uncharacterized Protein C20orf201, Chromosome 20 Open Reading Frame 201)

Ask
View Details
Fibrillin 1 Recombinant Protein Antigen
NBP2-52885PEP 0.1 mL

Fibrillin 1 Recombinant Protein Antigen

Ask
View Details
PIWIL1 (Piwi-like Protein 1, Piwil1, Miwi) discontinued
225052-01 50 µL

PIWIL1 (Piwi-like Protein 1, Piwil1, Miwi) discontinued

Ask
View Details
PIWIL1 (Piwi-like Protein 1, Piwil1, Miwi) discontinued
225052-02 100 µL

PIWIL1 (Piwi-like Protein 1, Piwil1, Miwi) discontinued

Ask
View Details
TSC22D3, ID (TSC22D3, DSIPI, GILZ, TSC22 domain family protein 3, DSIP-immunoreactive peptide, Delta sleep-inducing peptide immunoreactor, Glucocorticoid-induced leucine zipper protein, TSC-22-like protein, TSC-22-related protein) (MaxLight 650) discontinued
043356-ML650 100 µL

TSC22D3, ID (TSC22D3, DSIPI, GILZ, TSC22 domain family protein 3, DSIP-immunoreactive peptide, Delta sleep-inducing peptide immunoreactor, Glucocorticoid-induced leucine zipper protein, TSC-22-like protein, TSC-22-related protein) (MaxLight 650) discontinued

Ask
View Details
Recombinant Human DIRAS family, GTP-binding RAS-like 1
MBS144315-01 0.002 mg

Recombinant Human DIRAS family, GTP-binding RAS-like 1

Ask
View Details