Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-8e, Human

FGF-8e Protein, Human is an isoform of FGF-8, an essential factor during embryonic development, involved in the progression of prostate cancer.

Product Specifications

Product Name Alternative

FGF-8e Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-8e-protein-human.html

Smiles

MQEGPGRGPALGRELASLFRAGREPQGVSQQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR

Molecular Formula

2253 (Gene_ID) P55075-1 (Q23-R233) (Accession)

Molecular Weight

Approximately 24.3 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Harpain F, et al. FGF8 induces therapy resistance in neoadjuvantly radiated rectal cancer. J Cancer Res Clin Oncol. 2019 Jan;145 (1) :77-86.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Parvovirus B19 VP2 VLPs, Recomb
MBS319913-01 1 mg

Parvovirus B19 VP2 VLPs, Recomb

Sign In for Pricing
View Details
Parvovirus B19 VP2 VLPs, Recomb
MBS319913-02 5x 1 mg

Parvovirus B19 VP2 VLPs, Recomb

Sign In for Pricing
View Details
MRPL46 Polyclonal Conjugated Antibody
C28962 100 µL

MRPL46 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Victoria Blue R
T87618-01 10 mg

Victoria Blue R

Sign In for Pricing
View Details
Victoria Blue R
T87618-02 50 mg

Victoria Blue R

Sign In for Pricing
View Details
PDGFB Antibody
orb2683716-01 50 µL

PDGFB Antibody

Sign In for Pricing
View Details