Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-8e, Human

FGF-8e Protein, Human is an isoform of FGF-8, an essential factor during embryonic development, involved in the progression of prostate cancer.

Product Specifications

Product Name Alternative

FGF-8e Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-8e-protein-human.html

Smiles

MQEGPGRGPALGRELASLFRAGREPQGVSQQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR

Molecular Formula

2253 (Gene_ID) P55075-1 (Q23-R233) (Accession)

Molecular Weight

Approximately 24.3 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Harpain F, et al. FGF8 induces therapy resistance in neoadjuvantly radiated rectal cancer. J Cancer Res Clin Oncol. 2019 Jan;145 (1) :77-86.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

HSF4 (Heat Shock Factor Protein 4, HSF 4, hHSF4, Heat Shock Transcription Factor 4, HSTF 4) (MaxLight 750)
MBS6381780-01 0.1 mL

HSF4 (Heat Shock Factor Protein 4, HSF 4, hHSF4, Heat Shock Transcription Factor 4, HSTF 4) (MaxLight 750)

Ask
View Details
HSF4 (Heat Shock Factor Protein 4, HSF 4, hHSF4, Heat Shock Transcription Factor 4, HSTF 4) (MaxLight 750)
MBS6381780-02 5x 0.1 mL

HSF4 (Heat Shock Factor Protein 4, HSF 4, hHSF4, Heat Shock Transcription Factor 4, HSTF 4) (MaxLight 750)

Ask
View Details
Polyclonal Antibody to C Reactive Protein (CRP)
MBS2026428-01 0.1 mL

Polyclonal Antibody to C Reactive Protein (CRP)

Ask
View Details
Polyclonal Antibody to C Reactive Protein (CRP)
MBS2026428-02 0.2 mL

Polyclonal Antibody to C Reactive Protein (CRP)

Ask
View Details
Polyclonal Antibody to C Reactive Protein (CRP)
MBS2026428-03 0.5 mL

Polyclonal Antibody to C Reactive Protein (CRP)

Ask
View Details
Polyclonal Antibody to C Reactive Protein (CRP)
MBS2026428-04 1 mL

Polyclonal Antibody to C Reactive Protein (CRP)

Ask
View Details