Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-8e, Human

FGF-8e Protein, Human is an isoform of FGF-8, an essential factor during embryonic development, involved in the progression of prostate cancer.

Product Specifications

Product Name Alternative

FGF-8e Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-8e-protein-human.html

Smiles

MQEGPGRGPALGRELASLFRAGREPQGVSQQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR

Molecular Formula

2253 (Gene_ID) P55075-1 (Q23-R233) (Accession)

Molecular Weight

Approximately 24.3 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Harpain F, et al. FGF8 induces therapy resistance in neoadjuvantly radiated rectal cancer. J Cancer Res Clin Oncol. 2019 Jan;145 (1) :77-86.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tivozanib (VEGFR inhibitor)
SF5386-25mg 25 mg

Tivozanib (VEGFR inhibitor)

Sign In for Pricing
View Details
MXRA7 CytoSection
TS420082P5 25 Slides

MXRA7 CytoSection

Sign In for Pricing
View Details
DDX24 Lentiviral Activation Particles (m2)
sc-424214-LAC-2 200 µL

DDX24 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Rabbit anti-Drosophila melanogaster (Fruit fly) Act87E Polyclonal Antibody
MBS7152133 Inquire

Rabbit anti-Drosophila melanogaster (Fruit fly) Act87E Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Anti Protein S Antibody ELISA Kit
GTR10473289 96 Well

Mouse Anti Protein S Antibody ELISA Kit

Sign In for Pricing
View Details
Ints7 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6573002 1.0 µg DNA

Ints7 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details