Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MDC/CCL22, Rat

CCL22/MDC Protein, Rat is a CC chemokine that acts as a ligand for the CCR4 receptor and is a chemoattractant for CCR4-expressing cells such as Th2 cells, playing an important role in homeostatic and inflammatory responses. CCL22/MDC Protein, Rat is a recombinant rat CCL22/MDC (G25-A92) protein expressed by E. coli[1][2].

Product Specifications

Product Name Alternative

MDC/CCL22 Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mdc-ccl22-protein-rat.html

Purity

95.00

Smiles

GPYGANVEDSICCQDYIRHPLPPRFVKEFYWTSKSCRKPGVVLITIKNRDICADPRMLWVKKILHKLA

Molecular Formula

117551 (Gene_ID) Q5I0L5 (G25-A92) (Accession)

Molecular Weight

Approximately 10 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Yano C, et al. Mechanism of Macrophage-Derived Chemokine/CCL22 Production by HaCaT Keratinocytes. Ann Dermatol. 2015 Apr;27 (2) :152-6.|[2]Jan Korbecki, et al. CC Chemokines in a Tumor: A Review of Pro-Cancer and Anti-Cancer Properties of the Ligands of Receptors CCR1, CCR2, CCR3, and CCR4. Int J Mol Sci. 2020 Nov 9;21 (21) :8412.|[3]Stefanie Scheu, et al. The C-C Chemokines CCL17 and CCL22 and Their Receptor CCR4 in CNS Autoimmunity. Int J Mol Sci. 2017 Nov 2;18 (11) :2306.|[4]T Inoue, et al. CCL22 and CCL17 in rat radiation pneumonitis and in human idiopathic pulmonary fibrosis. Eur Respir J. 2004 Jul;24 (1) :49-56.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CXCR4, NT (C-X-C Chemokine Receptor Type 4, FB22, Fusin, HM89, LCR1, Leukocyte-derived Seven Transmembrane Domain Receptor, NPYRL, Stromal Cell-derived Factor 1 Receptor, CD184) (PE)
MBS6444654-01 0.1 mL

CXCR4, NT (C-X-C Chemokine Receptor Type 4, FB22, Fusin, HM89, LCR1, Leukocyte-derived Seven Transmembrane Domain Receptor, NPYRL, Stromal Cell-derived Factor 1 Receptor, CD184) (PE)

Sign In for Pricing
View Details
CXCR4, NT (C-X-C Chemokine Receptor Type 4, FB22, Fusin, HM89, LCR1, Leukocyte-derived Seven Transmembrane Domain Receptor, NPYRL, Stromal Cell-derived Factor 1 Receptor, CD184) (PE)
MBS6444654-02 5x 0.1 mL

CXCR4, NT (C-X-C Chemokine Receptor Type 4, FB22, Fusin, HM89, LCR1, Leukocyte-derived Seven Transmembrane Domain Receptor, NPYRL, Stromal Cell-derived Factor 1 Receptor, CD184) (PE)

Sign In for Pricing
View Details
ELF1 (ETS-related Transcription Factor Elf-1, E74-like Factor 1) (MaxLight 490)
MBS6200642-01 0.1 mL

ELF1 (ETS-related Transcription Factor Elf-1, E74-like Factor 1) (MaxLight 490)

Sign In for Pricing
View Details
ELF1 (ETS-related Transcription Factor Elf-1, E74-like Factor 1) (MaxLight 490)
MBS6200642-02 5x 0.1 mL

ELF1 (ETS-related Transcription Factor Elf-1, E74-like Factor 1) (MaxLight 490)

Sign In for Pricing
View Details
Phospho-PTPN7 (Ser93) Polyclonal Antibody, PE-Cy5 Conjugated
bs-5558R-PE-Cy5 100 µL

Phospho-PTPN7 (Ser93) Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
E-Selectin ELISA Kit (Human) (OKBB00247)
OKBB00247 96 Tests

E-Selectin ELISA Kit (Human) (OKBB00247)

Sign In for Pricing
View Details