Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGF-I/IGF-1, Mouse (N-His)

The IGF-I/IGF-1 protein is structurally similar to insulin and has potent growth-promoting activity. As a physiological regulator, it stimulates glucose transport and glycogen synthesis in osteoblasts, exceeding the efficacy of insulin at lower concentrations. IGF-I/IGF-1 Protein, Mouse (N-His) is the recombinant mouse-derived IGF-I/IGF-1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IGF-I/IGF-1 Protein, Mouse (N-His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igf-i-igf-1-protein-mouse-n-his.html

Purity

98.0

Smiles

GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAA

Molecular Formula

16000 (Gene_ID) P05017-1 (G49-A118) (Accession)

Molecular Weight

Approximately 10 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (CRIS-7), CF405S conjugate, 0.1mg/mL
BNC041050-100 1x 100 µL

CD3e (CRIS-7), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Parathyroid Hormone (PTH) (N-Terminal) (PTH/2295R), CF568 conjugate, 0.1mg/mL
BNC682295-500 1x 500 µL

Parathyroid Hormone (PTH) (N-Terminal) (PTH/2295R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (ICAM3/1019), CF647 conjugate, 0.1mg/mL
BNC471019-500 1x 500 µL

CD50 (ICAM-3) (ICAM3/1019), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Emerin (Papillary Thyroid Carcinoma and EDMD Marker) (EMD/2168), CF488A conjugate, 0.1mg/mL
BNC882168-100 1x 100 µL

Emerin (Papillary Thyroid Carcinoma and EDMD Marker) (EMD/2168), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Glypican-3 (1G12), CF488A conjugate, 0.1mg/mL
BNC880862-500 1x 500 µL

Glypican-3 (1G12), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nucleolin (364-5 + NCL/902), CF640R conjugate, 0.1mg/mL
BNC401205-500 1x 500 µL

Nucleolin (364-5 + NCL/902), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details