Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGF-I/IGF-1, Mouse (N-His)

The IGF-I/IGF-1 protein is structurally similar to insulin and has potent growth-promoting activity. As a physiological regulator, it stimulates glucose transport and glycogen synthesis in osteoblasts, exceeding the efficacy of insulin at lower concentrations. IGF-I/IGF-1 Protein, Mouse (N-His) is the recombinant mouse-derived IGF-I/IGF-1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IGF-I/IGF-1 Protein, Mouse (N-His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igf-i-igf-1-protein-mouse-n-his.html

Purity

98.0

Smiles

GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAA

Molecular Formula

16000 (Gene_ID) P05017-1 (G49-A118) (Accession)

Molecular Weight

Approximately 10 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CES2 Antibody
E91514 100 µL

CES2 Antibody

Sign In for Pricing
View Details
KLHL32 (NM_001286254) Human Untagged Clone
SC334026 10 µg

KLHL32 (NM_001286254) Human Untagged Clone

Sign In for Pricing
View Details
Human CGRRF1 Pre-designed siRNA Set B
SI002956B 1 Each

Human CGRRF1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Lentiviral mouse Fgf20 shRNA (UAS) - Lentiviral mouse Fgf20 shRNA (UAS, iRFP) plasmid
GTR15217132 1 Vial

Lentiviral mouse Fgf20 shRNA (UAS) - Lentiviral mouse Fgf20 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
TIFA sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2373307 1.0 µg DNA

TIFA sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Phospho-Artemis (Ser516) Rabbit pAb, 1 pack = 50 µL
BAL2681 1 Each

Phospho-Artemis (Ser516) Rabbit pAb, 1 pack = 50 µL

Sign In for Pricing
View Details