MCP-5/CCL12, Rat
The MCP-5/CCL12 protein belongs to the intercrine beta family and is essential for chemokines involved in intercellular communication and immune responses. In this family, MCP-5/CCL12 may play a role in regulating inflammatory processes and cellular interactions. MCP-5/CCL12 Protein, Rat is the recombinant rat-derived MCP-5/CCL12 protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
MCP-5/CCL12 Protein, Rat, Rat, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/mcp-5-ccl12-protein-rat.html
Purity
95.0
Smiles
GPYGANVEDSICCQDYIRHPLPPRFVKEFYWTSKSCRKPGVVLITIKNRDICADPRMLWVKKILHKLA
Molecular Formula
/ (Gene_ID) Q9QZU1 (G14-A81) (Accession)
Molecular Weight
Approximately 9 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Human Myosin light chain 6B (MYL6B) ELISA Kit
Human Myosin light chain 6B (MYL6B) ELISA Kit
Low Sample Volume Mouse Chemokine (C-C motif) ligand 6 / C10 (CCL6) ELISA Kit
Low Sample Volume Mouse Chemokine (C-C motif) ligand 6 / C10 (CCL6) ELISA Kit
Low Sample Volume Mouse Chemokine (C-C motif) ligand 6 / C10 (CCL6) ELISA Kit
