Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Agouti-related protein (AGRP)

Product Specifications

CAS Number

9000-83-3

Gene Name

AGRP

UniProt

O00253

Expression Region

83-132aa

Organism

Homo sapiens

Target Sequence

SSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT

Tag

N-terminal GST-tagged

Source

E.coli

Field of Research

Cardiovascular

Assay Type

Developed Protein

Relevance

Plays a role in weight homeostasis. Involved in the control of feeding behavior through the central melanocortin syst. Acts as alpha melanocyte-stimulating hormone antagonist by inhibiting cAMP production mediated by stimulation of melanocortin receptors within the hypothalamus and adrenal gland. Has very low activity with MC5R . Is an inverse agonist for MC3R and MC4R being able to suppress their constitutive activity. It promotes MC3R and MC4R endocytosis in an arrestin-dependent manner.5 Publications

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Length

Full Length of Mature Protein

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Plays a role in weight homeostasis. Involved in the control of feeding behavior through the central melanocortin system. Acts as alpha melanocyte-stimulating hormone antagonist by inhibiting cAMP production mediated by stimulation of melanocortin receptors within the hypothalamus and adrenal gland. Has very low activity with MC5R (By similarity). Is an inverse agonist for MC3R and MC4R being able to suppress their constitutive activity. It promotes MC3R and MC4R endocytosis in an arrestin-dependent manner.

Molecular Weight

32.7 kDa

References & Citations

Characterization of Agouti-related protein binding to melanocortin receptors.Yang Y.K., Thompson D.A., Dickinson C.J., Wilken J., Barsh G.S., Kent S.B., Gantz I.Mol. Endocrinol. 13:148-155 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

anti-human CD44-FITC
MBS666008-01 120 Tests

anti-human CD44-FITC

Ask
View Details
anti-human CD44-FITC
MBS666008-02 5x 120 Tests

anti-human CD44-FITC

Ask
View Details
Mouse TATA Box Binding Protein Associated Factor 12 (TAF12) ELISA Kit
abx154728-01 96 Tests

Mouse TATA Box Binding Protein Associated Factor 12 (TAF12) ELISA Kit

Ask
View Details
Mouse TATA Box Binding Protein Associated Factor 12 (TAF12) ELISA Kit
abx154728-02 5x 96 Tests

Mouse TATA Box Binding Protein Associated Factor 12 (TAF12) ELISA Kit

Ask
View Details
Mouse TATA Box Binding Protein Associated Factor 12 (TAF12) ELISA Kit
abx154728-03 10x 96 Tests

Mouse TATA Box Binding Protein Associated Factor 12 (TAF12) ELISA Kit

Ask
View Details
FOXC2 (Forkhead Box C2 (MFH-1, Mesenchyme Forkhead 1), FKHL14, LD, MFH-1, MFH1) (AP)
MBS6165311-01 0.1 mL

FOXC2 (Forkhead Box C2 (MFH-1, Mesenchyme Forkhead 1), FKHL14, LD, MFH-1, MFH1) (AP)

Ask
View Details