Neuregulin-4/NRG4, Human
Neuregulin-4 (NRG4) Protein, a low-affinity ligand for the ERBB4 tyrosine kinase receptor, serves as a signaling molecule that recruits ERBB1 and ERBB2 coreceptors. This recruitment leads to ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. NRG4 specifically interacts with the ERBB4 receptor, mediating cellular responses through its activation, without binding to ERBB1, ERBB2, and ERBB3 receptors. Neuregulin-4/NRG4 Protein, Human is the recombinant human-derived Neuregulin-4/NRG4 protein, expressed by E. coli, with tag free.
Product Specifications
Product Name Alternative
Neuregulin-4/NRG4 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/neuregulin-4-nrg4-protein-human.html
Purity
94.20
Smiles
GPPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNLF
Molecular Formula
145957 (Gene_ID) Q8WWG1 (N-G&P, P2-F62) (Accession)
Molecular Weight
Approximately 6.7-14 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
TipOne 10 uL XL ultra micro filter tip refill starter pack. Includes one box with ten racks of filter tips and one box of ten filter tip refill cassettes (total 1920 tips) . Sterile.
KIR2DS1, ID (KIR2DS1, CD158H, Killer cell immunoglobulin-like receptor 2DS1, CD158 antigen-like family member H, MHC class I NK cell receptor Eb6 ActI, CD158h) (MaxLight 490)
KIR2DS1, ID (KIR2DS1, CD158H, Killer cell immunoglobulin-like receptor 2DS1, CD158 antigen-like family member H, MHC class I NK cell receptor Eb6 ActI, CD158h) (MaxLight 490)
