Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neuregulin-4/NRG4, Human

Neuregulin-4 (NRG4) Protein, a low-affinity ligand for the ERBB4 tyrosine kinase receptor, serves as a signaling molecule that recruits ERBB1 and ERBB2 coreceptors. This recruitment leads to ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. NRG4 specifically interacts with the ERBB4 receptor, mediating cellular responses through its activation, without binding to ERBB1, ERBB2, and ERBB3 receptors. Neuregulin-4/NRG4 Protein, Human is the recombinant human-derived Neuregulin-4/NRG4 protein, expressed by E. coli, with tag free.

Product Specifications

Product Name Alternative

Neuregulin-4/NRG4 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/neuregulin-4-nrg4-protein-human.html

Purity

94.20

Smiles

GPPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNLF

Molecular Formula

145957 (Gene_ID) Q8WWG1 (N-G&P, P2-F62) (Accession)

Molecular Weight

Approximately 6.7-14 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1073 Protein Vector (Rat) (pPB-C-His)
PV287022 500 ng

Olr1073 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
PIK3AP1 (BCAP, Phosphoinositide 3-kinase Adapter Protein 1, B Cell Adapter for Phosphoinositide 3-kinase, B Cell Phosphoinositide 3-kinase Adapter Protein 1) (MaxLight 650)
131336-ML650 100 µL

PIK3AP1 (BCAP, Phosphoinositide 3-kinase Adapter Protein 1, B Cell Adapter for Phosphoinositide 3-kinase, B Cell Phosphoinositide 3-kinase Adapter Protein 1) (MaxLight 650)

Sign In for Pricing
View Details
FBXO6 Recombinant Protein (Mouse)
RP134069 100 µg

FBXO6 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Fibroblast Growth Factor 6, Recombinant, Human (FGF6)
MBS650883-01 0.025 mg

Fibroblast Growth Factor 6, Recombinant, Human (FGF6)

Sign In for Pricing
View Details
Fibroblast Growth Factor 6, Recombinant, Human (FGF6)
MBS650883-02 5x 0.025 mg

Fibroblast Growth Factor 6, Recombinant, Human (FGF6)

Sign In for Pricing
View Details
Phenanthrene, 4,5-dichloro-
JH919804 1 Each

Phenanthrene, 4,5-dichloro-

Sign In for Pricing
View Details