Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neuregulin-4/NRG4, Human

Neuregulin-4 (NRG4) Protein, a low-affinity ligand for the ERBB4 tyrosine kinase receptor, serves as a signaling molecule that recruits ERBB1 and ERBB2 coreceptors. This recruitment leads to ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. NRG4 specifically interacts with the ERBB4 receptor, mediating cellular responses through its activation, without binding to ERBB1, ERBB2, and ERBB3 receptors. Neuregulin-4/NRG4 Protein, Human is the recombinant human-derived Neuregulin-4/NRG4 protein, expressed by E. coli, with tag free.

Product Specifications

Product Name Alternative

Neuregulin-4/NRG4 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/neuregulin-4-nrg4-protein-human.html

Purity

94.20

Smiles

GPPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNLF

Molecular Formula

145957 (Gene_ID) Q8WWG1 (N-G&P, P2-F62) (Accession)

Molecular Weight

Approximately 6.7-14 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Filamin A (FLNA) (NM_001110556) Human Tagged ORF Clone
RC226488 10 µg

Filamin A (FLNA) (NM_001110556) Human Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit Polyclonal Ribosome maturation protein SBDS Antibody [DyLight 594]
NBP2-98463DL594 0.1 mL

Rabbit Polyclonal Ribosome maturation protein SBDS Antibody [DyLight 594]

Sign In for Pricing
View Details
ACSL1 antibody
70R-6456 50 ug

ACSL1 antibody

Sign In for Pricing
View Details
ErbB2 (Receptor Tyrosine-protein Kinase erbB-2, Metastatic Lymph Node Gene 19 Protein, MLN 19, Proto-oncogene Neu, Proto-oncogene c-ErbB-2, Tyrosine Kinase-type Cell Surface Receptor HER2, CD340, p185erbB2, HER2, MLN19, NEU, NGL) (Biotin) discontinued
217343-Biotin 100 µL

ErbB2 (Receptor Tyrosine-protein Kinase erbB-2, Metastatic Lymph Node Gene 19 Protein, MLN 19, Proto-oncogene Neu, Proto-oncogene c-ErbB-2, Tyrosine Kinase-type Cell Surface Receptor HER2, CD340, p185erbB2, HER2, MLN19, NEU, NGL) (Biotin) discontinued

Sign In for Pricing
View Details
Mouse Glucoside Xylosyltransferase 2 (GXYLT2) ELISA kit
YLA1007MO-01 48 Tests

Mouse Glucoside Xylosyltransferase 2 (GXYLT2) ELISA kit

Sign In for Pricing
View Details
Mouse Glucoside Xylosyltransferase 2 (GXYLT2) ELISA kit
YLA1007MO-02 96 Tests

Mouse Glucoside Xylosyltransferase 2 (GXYLT2) ELISA kit

Sign In for Pricing
View Details