Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neuregulin-4/NRG4, Human

Neuregulin-4 (NRG4) Protein, a low-affinity ligand for the ERBB4 tyrosine kinase receptor, serves as a signaling molecule that recruits ERBB1 and ERBB2 coreceptors. This recruitment leads to ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. NRG4 specifically interacts with the ERBB4 receptor, mediating cellular responses through its activation, without binding to ERBB1, ERBB2, and ERBB3 receptors. Neuregulin-4/NRG4 Protein, Human is the recombinant human-derived Neuregulin-4/NRG4 protein, expressed by E. coli, with tag free.

Product Specifications

Product Name Alternative

Neuregulin-4/NRG4 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/neuregulin-4-nrg4-protein-human.html

Purity

94.20

Smiles

GPPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNLF

Molecular Formula

145957 (Gene_ID) Q8WWG1 (N-G&P, P2-F62) (Accession)

Molecular Weight

Approximately 6.7-14 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GLRA4 Human shRNA Plasmid Kit (Locus ID 441509)
TR320792 1 Kit

GLRA4 Human shRNA Plasmid Kit (Locus ID 441509)

Sign In for Pricing
View Details
1-Benzoylcyclohexanol
408801-01 5 g

1-Benzoylcyclohexanol

Sign In for Pricing
View Details
1-Benzoylcyclohexanol
408801-02 25 g

1-Benzoylcyclohexanol

Sign In for Pricing
View Details
Wfdc3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
50407116 3x 1.0 µg

Wfdc3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Kpna6 (NM_001015029) Rat Tagged ORF Clone
RR210435 10 µg

Kpna6 (NM_001015029) Rat Tagged ORF Clone

Sign In for Pricing
View Details
ENO1 Recombinant Protein (Rat)
RP199622 100 µg

ENO1 Recombinant Protein (Rat)

Sign In for Pricing
View Details