Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neuregulin-4/NRG4, Human

Neuregulin-4 (NRG4) Protein, a low-affinity ligand for the ERBB4 tyrosine kinase receptor, serves as a signaling molecule that recruits ERBB1 and ERBB2 coreceptors. This recruitment leads to ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. NRG4 specifically interacts with the ERBB4 receptor, mediating cellular responses through its activation, without binding to ERBB1, ERBB2, and ERBB3 receptors. Neuregulin-4/NRG4 Protein, Human is the recombinant human-derived Neuregulin-4/NRG4 protein, expressed by E. coli, with tag free.

Product Specifications

Product Name Alternative

Neuregulin-4/NRG4 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/neuregulin-4-nrg4-protein-human.html

Purity

94.20

Smiles

GPPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNLF

Molecular Formula

145957 (Gene_ID) Q8WWG1 (N-G&P, P2-F62) (Accession)

Molecular Weight

Approximately 6.7-14 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Cadherin-17 Antibody (029) [CoraFluor 1]
NBP2-89891CL1 0.1 mL

Rabbit Monoclonal Cadherin-17 Antibody (029) [CoraFluor 1]

Sign In for Pricing
View Details
Lentiviral human PADI4 shRNA (UAS) - Lentiviral human PADI4 shRNA (UAS, GFP) (25)
GTR15313103 1 Vial

Lentiviral human PADI4 shRNA (UAS) - Lentiviral human PADI4 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
PerCP/Cyanine5.5 anti-human CD182 (CXCR2)
GT09842 100 Tests

PerCP/Cyanine5.5 anti-human CD182 (CXCR2)

Sign In for Pricing
View Details
ZNF570 Human shRNA Lentiviral Particle (Locus ID 148268)
TL307531V 500 µL Each

ZNF570 Human shRNA Lentiviral Particle (Locus ID 148268)

Sign In for Pricing
View Details
TMEM209 (F-5) Alexa Fluor® 546
sc-515223 AF546 200 µg/mL

TMEM209 (F-5) Alexa Fluor® 546

Sign In for Pricing
View Details
LY 2183240 10mM * 1mL in DMSO
A11960-10mM-D 10 mM x 1mL in DMSO

LY 2183240 10mM * 1mL in DMSO

Sign In for Pricing
View Details