Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neuregulin-4/NRG4, Human

Neuregulin-4 (NRG4) Protein, a low-affinity ligand for the ERBB4 tyrosine kinase receptor, serves as a signaling molecule that recruits ERBB1 and ERBB2 coreceptors. This recruitment leads to ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. NRG4 specifically interacts with the ERBB4 receptor, mediating cellular responses through its activation, without binding to ERBB1, ERBB2, and ERBB3 receptors. Neuregulin-4/NRG4 Protein, Human is the recombinant human-derived Neuregulin-4/NRG4 protein, expressed by E. coli, with tag free.

Product Specifications

Product Name Alternative

Neuregulin-4/NRG4 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/neuregulin-4-nrg4-protein-human.html

Purity

94.20

Smiles

GPPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNLF

Molecular Formula

145957 (Gene_ID) Q8WWG1 (N-G&P, P2-F62) (Accession)

Molecular Weight

Approximately 6.7-14 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

WISP1 Antibody, Biotin conjugated
A38457-100UG 100 µg

WISP1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Chicken Fibrinopeptide A (FPA) ELISA Kit
abx355815 96 Well

Chicken Fibrinopeptide A (FPA) ELISA Kit

Sign In for Pricing
View Details
MCOLN2 (NM_153259) Human Over-expression Lysate
LY407109 100 µg

MCOLN2 (NM_153259) Human Over-expression Lysate

Sign In for Pricing
View Details
ATXN7L1 isoform 2
520423-01 100 µL

ATXN7L1 isoform 2

Sign In for Pricing
View Details
ATXN7L1 isoform 2
520423-02 200 µL

ATXN7L1 isoform 2

Sign In for Pricing
View Details
CRELD1 Rabbit pAb
E47R14055 100 µL

CRELD1 Rabbit pAb

Sign In for Pricing
View Details