Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neuregulin-4/NRG4, Human

Neuregulin-4 (NRG4) Protein, a low-affinity ligand for the ERBB4 tyrosine kinase receptor, serves as a signaling molecule that recruits ERBB1 and ERBB2 coreceptors. This recruitment leads to ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. NRG4 specifically interacts with the ERBB4 receptor, mediating cellular responses through its activation, without binding to ERBB1, ERBB2, and ERBB3 receptors. Neuregulin-4/NRG4 Protein, Human is the recombinant human-derived Neuregulin-4/NRG4 protein, expressed by E. coli, with tag free.

Product Specifications

Product Name Alternative

Neuregulin-4/NRG4 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/neuregulin-4-nrg4-protein-human.html

Purity

94.20

Smiles

GPPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNLF

Molecular Formula

145957 (Gene_ID) Q8WWG1 (N-G&P, P2-F62) (Accession)

Molecular Weight

Approximately 6.7-14 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

pEGFP-N1-IL10 Plasmid
PVT7214 2 µg

pEGFP-N1-IL10 Plasmid

Sign In for Pricing
View Details
CCT8L2 (Putative T-complex Protein 1 Subunit theta-like 2, CESK1, MGC118839, MGC118840) (MaxLight 650)
MBS6372737-01 0.1 mL

CCT8L2 (Putative T-complex Protein 1 Subunit theta-like 2, CESK1, MGC118839, MGC118840) (MaxLight 650)

Sign In for Pricing
View Details
CCT8L2 (Putative T-complex Protein 1 Subunit theta-like 2, CESK1, MGC118839, MGC118840) (MaxLight 650)
MBS6372737-02 5x 0.1 mL

CCT8L2 (Putative T-complex Protein 1 Subunit theta-like 2, CESK1, MGC118839, MGC118840) (MaxLight 650)

Sign In for Pricing
View Details
APC-Labeled Human HLA-A*02:01&B2M&WT-1 (RMFPNAPYL) Tetramer Protein
HLW-HA2H6-25ug 25 µg

APC-Labeled Human HLA-A*02:01&B2M&WT-1 (RMFPNAPYL) Tetramer Protein

Sign In for Pricing
View Details
Guinea pig GAL3 (Galectin 3) ELISA Kit
MBS2508537-01 24 Tests

Guinea pig GAL3 (Galectin 3) ELISA Kit

Sign In for Pricing
View Details
Guinea pig GAL3 (Galectin 3) ELISA Kit
MBS2508537-02 48 Tests

Guinea pig GAL3 (Galectin 3) ELISA Kit

Sign In for Pricing
View Details