Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neuregulin-4/NRG4, Human

Neuregulin-4 (NRG4) Protein, a low-affinity ligand for the ERBB4 tyrosine kinase receptor, serves as a signaling molecule that recruits ERBB1 and ERBB2 coreceptors. This recruitment leads to ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. NRG4 specifically interacts with the ERBB4 receptor, mediating cellular responses through its activation, without binding to ERBB1, ERBB2, and ERBB3 receptors. Neuregulin-4/NRG4 Protein, Human is the recombinant human-derived Neuregulin-4/NRG4 protein, expressed by E. coli, with tag free.

Product Specifications

Product Name Alternative

Neuregulin-4/NRG4 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/neuregulin-4-nrg4-protein-human.html

Purity

94.20

Smiles

GPPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNLF

Molecular Formula

145957 (Gene_ID) Q8WWG1 (N-G&P, P2-F62) (Accession)

Molecular Weight

Approximately 6.7-14 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LDL Receptor (LDLR) (NM_001195803) Human Tagged ORF Clone
RG231372 10 µg

LDL Receptor (LDLR) (NM_001195803) Human Tagged ORF Clone

Sign In for Pricing
View Details
3-Chloro-4-methoxycarbonylphenylboronic acid
424985-01 100 mg

3-Chloro-4-methoxycarbonylphenylboronic acid

Sign In for Pricing
View Details
3-Chloro-4-methoxycarbonylphenylboronic acid
424985-02 250 mg

3-Chloro-4-methoxycarbonylphenylboronic acid

Sign In for Pricing
View Details
UBR4 Human shRNA Plasmid Kit (Locus ID 23352)
TG300006 1 Kit

UBR4 Human shRNA Plasmid Kit (Locus ID 23352)

Sign In for Pricing
View Details
Felypressin acetate
MBS3847381-01 5 mg

Felypressin acetate

Sign In for Pricing
View Details
Felypressin acetate
MBS3847381-02 10 mg

Felypressin acetate

Sign In for Pricing
View Details